Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate WP_208610168.1 BUB13_RS12685 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02119 (397 letters) >NCBI__GCF_900142125.1:WP_208610168.1 Length = 249 Score = 87.4 bits (215), Expect = 4e-22 Identities = 48/122 (39%), Positives = 74/122 (60%) Query: 266 FMSLFLALSFYTAAFIAEIVRAGIRGVSKGQTEAAHALGIRPALTTRLVVVPQAMRIIIP 325 F S LALS + A+ +EI+RAGI + GQ EA+ +LG++P R +++PQA+R +IP Sbjct: 120 FSSAVLALSLFEGAYASEIIRAGILAIPLGQWEASASLGLKPPQIYRFIILPQAIRQMIP 179 Query: 326 PLTSQYLNLTKNSSLAVAIGYADLVAVGGTILNQTGQSIEIVSIWLIVYLSLSLATSLFM 385 PLTSQ ++L K+S+L I DL G I+ +T + EI +YL ++ SL + Sbjct: 180 PLTSQGISLIKDSALVSTIAIYDLTMQGQQIVAETFLTFEIWFTVAAIYLLVTTLLSLLV 239 Query: 386 NW 387 + Sbjct: 240 RY 241 Score = 41.6 bits (96), Expect = 2e-08 Identities = 26/94 (27%), Positives = 44/94 (46%) Query: 72 VGQSLISFTSDSTYGRALLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKLSLA 131 V + L T + LL G TL + + ++ + +IG + + RLS + + ++ Sbjct: 31 VPRYLYKITDEGWQAGPLLQGLWLTLEITVVSLLLSLVIGLLTALMRLSRSPMAKGIAWV 90 Query: 132 YVEVFRNIPPLLVIFFWYSGVLSILPQARDALAL 165 Y+E RN P L+ IF Y IL R + A+ Sbjct: 91 YLEAIRNTPLLIQIFIIYFVFAPILDLGRFSSAV 124 Lambda K H 0.327 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 249 Length adjustment: 27 Effective length of query: 370 Effective length of database: 222 Effective search space: 82140 Effective search space used: 82140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory