Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 311 bits (796), Expect = 2e-89 Identities = 157/261 (60%), Positives = 201/261 (77%) Query: 8 KIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGLS 67 KIEVKN++KIFG + K+A+ L++Q K+ + +T VGV D S I GEIFVIMGLS Sbjct: 6 KIEVKNLYKIFGPQPKKAMALLKQGLDKEAIFEKTETTVGVQDASFEIFKGEIFVIMGLS 65 Query: 68 GSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKSV 127 GSGKST+VR NRLI+PTSG +L+DGEDI+ ++ D L + RR K+SMVFQSF L+PH +V Sbjct: 66 GSGKSTMVRMLNRLIEPTSGQVLIDGEDIVAMNDDQLVKVRRAKLSMVFQSFALMPHMTV 125 Query: 128 LDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAADT 187 L N A+GL++ G KQ +RAL + VGL+ + P +LSGGM+QRVGLAR LA D Sbjct: 126 LQNAAFGLEMDGVDKQTREQRALQALEQVGLEAWAESMPDELSGGMQQRVGLARGLAVDP 185 Query: 188 DIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDGKL 247 DI+LMDEAFSALDPLIR EMQD+LL+LQ +TIVFI+HDLDEA+RIG+RIAI++ G++ Sbjct: 186 DILLMDEAFSALDPLIRTEMQDELLKLQAKAKRTIVFISHDLDEAMRIGDRIAIMEGGRV 245 Query: 248 IQVGTPREILHSPADEYVDRF 268 +QVGTP EIL +PAD+YV F Sbjct: 246 VQVGTPEEILQNPADDYVRAF 266 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 415 Length adjustment: 28 Effective length of query: 248 Effective length of database: 387 Effective search space: 95976 Effective search space used: 95976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory