Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_072905063.1 BUB13_RS01970 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_900142125.1:WP_072905063.1 Length = 267 Score = 184 bits (466), Expect = 2e-51 Identities = 97/255 (38%), Positives = 159/255 (62%), Gaps = 6/255 (2%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 LL +GL+ FGGLRAVD + V EG I LIGPNGAGKTT FN ++ P +G++L Sbjct: 7 LLEVKGLTMDFGGLRAVDSVSLEVHEGEIAALIGPNGAGKTTFFNCVTGIYNPTKGDILL 66 Query: 78 NGDSI-----GQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLIN 132 + + L P+++ G RTFQ ++ S +TVLEN+++ +T +I Sbjct: 67 HPKGLPTRRLNGLKPNKVTEMGLARTFQNIRLFSDMTVLENVMIGRHCRTSAGIFRSIIR 126 Query: 133 FRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDE 192 + V++EE+ E + +L+ VGL A ++A L G ++ LE+ARA+ + P L+LLDE Sbjct: 127 DKSVRREEQEIVESSYQLLKKVGLAEFANEFAKNLPYGAQRRLEIARAMATEPFLLLLDE 186 Query: 193 PAAGVNPTLIGQICEHIVNWN-RQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPE 251 PAAG+NP ++ + I + + I L+IEH+M ++M + + ++V+ G+ +A+G+P+ Sbjct: 187 PAAGMNPQETAELDQLICRISEEERIAILLIEHDMKLVMNISNPIYVMEYGKKIAEGSPQ 246 Query: 252 QIQSDPRVLEAYLGD 266 +I+ +P+V+EAYLG+ Sbjct: 247 EIKDNPKVIEAYLGE 261 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory