Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_072908495.1 BUB13_RS09995 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_900142125.1:WP_072908495.1 Length = 318 Score = 192 bits (487), Expect = 1e-53 Identities = 119/349 (34%), Positives = 196/349 (56%), Gaps = 50/349 (14%) Query: 1 MKNTKTNWIIGAVALL-VLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLG 59 MKN + + +A++ VLP +L W +A L++ ++AL +I++G +G+ ++G Sbjct: 1 MKNYEKFVLPAFIAVMAVLPHLLNE---RWQAVAITFLIFSVVALSQDIILGKSGMFNMG 57 Query: 60 YVAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAP 119 F+ +GAY A++ N S+ IP+A L+ A FG +L P Sbjct: 58 QALFFGMGAYTTAILN----------------NEYGWSIVSTIPLAILIPAIFGILLAGP 101 Query: 120 TLKLRGDYLAIVTLGFGEI-IRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEV 178 + LRGDYL +VT+GF + +++ NNL +T GP G+ +DS+ +FG DL Sbjct: 102 IVHLRGDYLLVVTIGFNIVFVQVLQNNLG---GVTGGPNGIFGLDSLSIFGYDL------ 152 Query: 179 FGFDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKL 238 +N V +YY+ F+VL++ ++ I L+ S+ GRA +RED++AA+++GINTR K+ Sbjct: 153 ----MNQVAVYYFAFIVLLL-TLWIMSNLEKSKPGRALHYLREDQLAAESIGINTRVYKI 207 Query: 239 LAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLS 298 AFG+GA G++G +F VSPE+F ++SV+ ++V++GG IPGV+LG ++ Sbjct: 208 FAFGLGAGIAGLAGTVFAVQYSAVSPEAFEFIQSVLFFSIVLVGG-SSIPGVMLGVFVMF 266 Query: 299 ALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWPS 347 +PE+ R + A R + AMI M+LRPRG+ P+ Sbjct: 267 VVPEIFR--------------EFATWRYFIFGFAMIAAMILRPRGIVPA 301 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 318 Length adjustment: 28 Effective length of query: 330 Effective length of database: 290 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory