Align LacK, component of Lactose porter (characterized)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 155 bits (391), Expect = 2e-42 Identities = 94/248 (37%), Positives = 139/248 (56%), Gaps = 9/248 (3%) Query: 19 IKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGELTIGG---TVMND---VDP 72 ++ + E+ GE V +G SG GKST++RM+ L + +SG++ I G MND V Sbjct: 46 VQDASFEIFKGEIFVIMGLSGSGKSTMVRMLNRLIEPTSGQVLIDGEDIVAMNDDQLVKV 105 Query: 73 SKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKILELDALMDRKPK 132 + ++MVFQ++AL PHMTV +N F L G+ K E+R A + + L+A + P Sbjct: 106 RRAKLSMVFQSFALMPHMTVLQNAAFGLEMDGVDKQTREQRALQALEQVGLEAWAESMPD 165 Query: 133 ALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLHKELNATIVYVTH 192 LSGG +QRV + R + PD+ L DE S LD +R M+ E+ +L + TIV+++H Sbjct: 166 ELSGGMQQRVGLARGLAVDPDILLMDEAFSALDPLIRTEMQDELLKLQAKAKRTIVFISH 225 Query: 193 DQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFI-GSPRMNFLPAVVIGQAE 251 D EAM + D+I +M GG V QVG P + +P + +V F G N L A I A Sbjct: 226 DLDEAMRIGDRIAIMEGGRVVQVGTPEEILQNPADDYVRAFFRGVDPTNILTAGDI--AT 283 Query: 252 GGQVTVAL 259 QVT+ + Sbjct: 284 QTQVTIPI 291 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 415 Length adjustment: 30 Effective length of query: 333 Effective length of database: 385 Effective search space: 128205 Effective search space used: 128205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory