Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_072905062.1 BUB13_RS01965 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_900142125.1:WP_072905062.1 Length = 235 Score = 263 bits (671), Expect = 3e-75 Identities = 136/233 (58%), Positives = 172/233 (73%), Gaps = 1/233 (0%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 MLK+ + T+YG I+ALK V +E+ GEIV+LIGANGAGK+T LM+ICG R G IT Sbjct: 1 MLKIKNIQTYYGNIQALKDVSLEVKEGEIVTLIGANGAGKTTTLMSICGITPPRSGEITL 60 Query: 61 EGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANE-LERVLTL 119 +G IT M ++V+ GI Q PEGRRIFP M+VLENL+MG+ K + L V+TL Sbjct: 61 DGDLITGMSAEKIVQQGIVQVPEGRRIFPDMTVLENLEMGAFLRKNKQLVQQDLNYVMTL 120 Query: 120 FPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDI 179 FP L++R +Q GT+SGGEQQMLAI RALM++PR+LLLDEPSLGLAPL++KQIF +K I Sbjct: 121 FPILEKRKNQLGGTLSGGEQQMLAISRALMARPRVLLLDEPSLGLAPLIIKQIFDILKQI 180 Query: 180 NREQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 N+E T+F+VEQNA ALKLA RGYVM NG++T+ LL N++VR AYL Sbjct: 181 NKENNTTIFLVEQNANQALKLADRGYVMENGRITLVDDADRLLENDDVRKAYL 233 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 235 Length adjustment: 23 Effective length of query: 213 Effective length of database: 212 Effective search space: 45156 Effective search space used: 45156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory