Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= TCDB::P31134 (377 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 181 bits (460), Expect = 2e-50 Identities = 104/254 (40%), Positives = 149/254 (58%), Gaps = 7/254 (2%) Query: 8 PQAKTRKALTPL-LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLA 66 PQ K AL L+ + + + V D S I+KGEIF ++G SG GKST++RML Sbjct: 18 PQPKKAMALLKQGLDKEAIFEKTETTVGVQDASFEIFKGEIFVIMGLSGSGKSTMVRMLN 77 Query: 67 GFEQPSAGQIMLDGVDL------SQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDK 120 +P++GQ+++DG D+ V ++M+FQS+AL PHMTV QN AFGL+ D Sbjct: 78 RLIEPTSGQVLIDGEDIVAMNDDQLVKVRRAKLSMVFQSFALMPHMTVLQNAAFGLEMDG 137 Query: 121 LPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGAL 180 + K R + L V ++ +A+ P +LSGG +QRV LAR LA P +LL+DE AL Sbjct: 138 VDKQTREQRALQALEQVGLEAWAESMPDELSGGMQQRVGLARGLAVDPDILLMDEAFSAL 197 Query: 181 DKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEH 240 D +R MQ E++ + + T V ++HD +EAM + RIAIM G+ VQ+G PEEI ++ Sbjct: 198 DPLIRTEMQDELLKLQAKAKRTIVFISHDLDEAMRIGDRIAIMEGGRVVQVGTPEEILQN 257 Query: 241 PTTRYSAEFIGSVN 254 P Y F V+ Sbjct: 258 PADDYVRAFFRGVD 271 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 415 Length adjustment: 31 Effective length of query: 346 Effective length of database: 384 Effective search space: 132864 Effective search space used: 132864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory