Align Glutamate--putrescine ligase (EC 6.3.1.11) (characterized)
to candidate WP_072904750.1 BUB13_RS00250 type I glutamate--ammonia ligase
Query= reanno::MR1:200446 (451 letters) >NCBI__GCF_900142125.1:WP_072904750.1 Length = 469 Score = 124 bits (312), Expect = 5e-33 Identities = 92/273 (33%), Positives = 136/273 (49%), Gaps = 18/273 (6%) Query: 142 TSRSDDHDLPLKPPIGRSGRPEAGRQSFSIDAANEYDPLFEDMYDWCEIQGLDIDTLIHE 201 T R + +L KP P A S ID NE + ++ GL I+ HE Sbjct: 161 TGREEFPNLGYKPRHKEGYFPCAPTDSM-IDLRNEMMMVLQE-------NGLHIECGHHE 212 Query: 202 DGPA-QMEINFSHGNPLSLADQVFVFKRTLREAALKHNVCATFMAKPVTDEPGSAMHIHQ 260 Q EI+ + L + D + FK ++ A+++ TFM KP+ ++ GS MH HQ Sbjct: 213 VATGGQCEIDMRFNSLLQMGDDLQWFKYIIKNVAVRNGKTVTFMPKPIYNDNGSGMHCHQ 272 Query: 261 SVINKETGKNIFTNED-GTQSALFLSYIAGLQKYIPEFLPLMAPNANSFRRFLPGTSAPV 319 S+ + GKN+F + G S + + YI G+ K+ P NS++R +PG APV Sbjct: 273 SLW--KDGKNLFAGDGYGGLSKMAMYYIGGIMKHAKALCAFTNPTTNSYKRLVPGFEAPV 330 Query: 320 NLEWGIENRTCGLRIPESSPQN-RRIENRIPGADANCYLAFAAGLLCGYIGMVEGLKPST 378 NL + NR+ LRIP ++ + +R+E R P A AN YLAFAA L+ G G+ + P Sbjct: 331 NLAYSNRNRSASLRIPVTNNEKAKRVEYRTPDASANGYLAFAAQLMAGLDGIENKIDPGQ 390 Query: 379 P----VQGKANESRSNNPHCLPLTLEEALVAME 407 P + G + E + P + TLEEAL +E Sbjct: 391 PLDKDIYGLSPEELKDIP-SVAGTLEEALNCLE 422 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 451 Length of database: 469 Length adjustment: 33 Effective length of query: 418 Effective length of database: 436 Effective search space: 182248 Effective search space used: 182248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory