Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_072908814.1 BUB13_RS11050 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= uniprot:P40735 (281 letters) >NCBI__GCF_900142125.1:WP_072908814.1 Length = 415 Score = 141 bits (355), Expect = 3e-38 Identities = 82/221 (37%), Positives = 133/221 (60%), Gaps = 6/221 (2%) Query: 16 YRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAG---IQ 72 + K + S ++++GE I+G +GSGKST+ R LN LI P SG + + G + Sbjct: 37 FEKTETTVGVQDASFEIFKGEIFVIMGLSGSGKSTMVRMLNRLIEPTSGQVLIDGEDIVA 96 Query: 73 LTEESVWEVRK-KIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVN 131 + ++ + +VR+ K+ MVFQ+ TV + AFGLE +GV ++ +R A++QV Sbjct: 97 MNDDQLVKVRRAKLSMVFQS-FALMPHMTVLQNAAFGLEMDGVDKQTREQRALQALEQVG 155 Query: 132 MQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQ 191 ++ + + P LSGG +QRV +A +A PDI+++DEA S LDP+ R E+ + + L+ + Sbjct: 156 LEAWAESMPDELSGGMQQRVGLARGLAVDPDILLMDEAFSALDPLIRTEMQDELLKLQAK 215 Query: 192 GMATVISITHDLNEAAK-ADRIIVMNGGKKYAEGPPEEIFK 231 T++ I+HDL+EA + DRI +M GG+ G PEEI + Sbjct: 216 AKRTIVFISHDLDEAMRIGDRIAIMEGGRVVQVGTPEEILQ 256 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 415 Length adjustment: 29 Effective length of query: 252 Effective length of database: 386 Effective search space: 97272 Effective search space used: 97272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory