Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_072908495.1 BUB13_RS09995 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_900142125.1:WP_072908495.1 Length = 318 Score = 187 bits (476), Expect = 3e-52 Identities = 111/335 (33%), Positives = 188/335 (56%), Gaps = 28/335 (8%) Query: 89 QKLFLVALLVLAVAWPFMVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAI 148 +K L A + + P +++ +A +I+ ++ L ++++G SG+ +G F+ + Sbjct: 5 EKFVLPAFIAVMAVLPHLLNERWQAVAITFLIFSVVALSQDIILGKSGMFNMGQALFFGM 64 Query: 149 GAYTFALLNHYYGLGFWTCLPIAGLMAAAAGFLLGFPVLRLRGDYLAIVTLGFGEI-VRI 207 GAYT A+LN+ YG + +P+A L+ A G LL P++ LRGDYL +VT+GF + V++ Sbjct: 65 GAYTTAILNNEYGWSIVSTIPLAILIPAIFGILLAGPIVHLRGDYLLVVTIGFNIVFVQV 124 Query: 208 LLLNNTEITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDRVIFLYLV 267 L N +TGGPNGI + ++FG YD ++V +Y Sbjct: 125 LQNNLGGVTGGPNGIFGLDSLSIFG----------------------YDLMNQVA-VYYF 161 Query: 268 ALLLVVLSLFVINRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFAGFAG 327 A ++++L+L++++ L + GRA LRED++A S+G++ R K+ AF + A AG AG Sbjct: 162 AFIVLLLTLWIMSNLEKSKPGRALHYLREDQLAAESIGINTRVYKIFAFGLGAGIAGLAG 221 Query: 328 TLFAARQGFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSM 387 T+FA + VSPE+F F +S +IV++GG S V+L ++ V E+ R+F + Sbjct: 222 TVFAVQYSAVSPEAFEFIQSVLFFSIVLVGG-SSIPGVMLGVFVMFVVPEIFREFATWRY 280 Query: 388 LMLGGLMVLMMIWRPQGLLPMT---RPQLKLKNGA 419 + G M+ MI RP+G++P T P+ +K G+ Sbjct: 281 FIFGFAMIAAMILRPRGIVPATFGKIPKFLIKGGS 315 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 318 Length adjustment: 30 Effective length of query: 395 Effective length of database: 288 Effective search space: 113760 Effective search space used: 113760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory