Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate WP_072910046.1 BUB13_RS17445 aldo/keto reductase
Query= BRENDA::F2YCN5 (340 letters) >NCBI__GCF_900142125.1:WP_072910046.1 Length = 329 Score = 140 bits (353), Expect = 4e-38 Identities = 92/283 (32%), Positives = 147/283 (51%), Gaps = 3/283 (1%) Query: 41 TDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIKGQRDNLIIATKVGLDWTLT 100 TD SI I A++ G+ DTA YG EE+VG+A+ RD +++ATK G + Sbjct: 31 TDKKESIALIRAAVERGVTFFDTAEVYGPFTNEELVGEALAPLRDQVVVATKFGFTFGDD 90 Query: 101 PDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHWPDPLVPIEETATILEALRKEGKI 160 Q + NS I+K E+SL+RL TD IDLY H DP VPIE+ A + L +EGK+ Sbjct: 91 GKQQIL-NSRPEHIRKVAEESLKRLKTDVIDLYYQHRVDPEVPIEDVAGTVRDLIREGKV 149 Query: 161 RSIGVSNYSVQQMDEFKKYAELAVSQSPYNLFEREIDKDILPYAKKNDLVVLGYGALCRG 220 R G+S + + + L QS Y+L+ RE +KDILP ++ + + + L +G Sbjct: 150 RHFGLSEAGAETIRRAHQVQPLTALQSEYSLWWREPEKDILPTLEELGIGFVPFSPLGKG 209 Query: 221 LLSGRMTADRAFTGDDLRKTDPKFQKPRFEHYLAAVEELKKLAKEHYNKSVLALAIRWML 280 L+G + D F+ +D R P+F + A V+ L ++A + +AI W++ Sbjct: 210 FLAGAINEDTTFSENDFRNIVPRFSPEARKANQALVDLLGEIAASK-QVTRAQIAIAWII 268 Query: 281 EQGPTLA-LWGACKPEQIDGIDEVFGWQISDEDLKQIDAILAK 322 Q P + + G K +++ ++ EDL I++ +A+ Sbjct: 269 AQKPWIVPIPGTTKLHRLEENLGAAKVKLEQEDLDNIESAVAR 311 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 329 Length adjustment: 28 Effective length of query: 312 Effective length of database: 301 Effective search space: 93912 Effective search space used: 93912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory