Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_078717009.1 B5D49_RS06865 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_900167125.1:WP_078717009.1 Length = 370 Score = 197 bits (502), Expect = 3e-55 Identities = 114/292 (39%), Positives = 174/292 (59%), Gaps = 15/292 (5%) Query: 2 TTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTS 61 + IR+E+++K F G+T + +V + I G +LGPSG GKTT LRL+AG E P+S Sbjct: 6 SVIRLEHVAKEFD-GET---VLHDVCLDIRHGEFLTILGPSGCGKTTLLRLLAGFESPSS 61 Query: 62 GYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIEN 121 G I D ++ + P+ R + VFQ++AL+P+M+VFDN+AF L+++ +PK +I Sbjct: 62 GEIILDGRSMRD-----VPPDGRRVNTVFQSYALFPHMSVFDNVAFGLRMSGIPKVEIGE 116 Query: 122 KVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESA 181 +V + +GL+G R P LSGGQ QR AIARA+V P VLLLDEP S LD ++R Sbjct: 117 RVAKALRMVGLAGQAGRRPTSLSGGQQQRVAIARAVVNRPLVLLLDEPLSALDYKLRVQM 176 Query: 182 RALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIAR 241 R +++++RE +T + V+HD + F+++++ V+ G AQ+GTP E+YE P +AR Sbjct: 177 RTELKQLRREMGITFIFVTHDQEEAFSMSDRVVVMNEGCVAQVGTPVEVYEQPVNMFVAR 236 Query: 242 LTGEINLIQAKIIENNAIIANLKVPLNNMELKGQ------SNIVIGLRPDDL 287 GE N+ + +++ I V EL I + LRP+DL Sbjct: 237 FVGETNVFEGVAGQSDGGILQALVEGRTCELSSHRGFQPGDRIRVLLRPEDL 288 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 370 Length adjustment: 30 Effective length of query: 341 Effective length of database: 340 Effective search space: 115940 Effective search space used: 115940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory