Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_078717009.1 B5D49_RS06865 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_900167125.1:WP_078717009.1 Length = 370 Score = 224 bits (572), Expect = 2e-63 Identities = 124/279 (44%), Positives = 175/279 (62%), Gaps = 9/279 (3%) Query: 21 LKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAILVDDADISGMSPKDRDIA 80 L ++ L I GEFL ++GPSGCGK+TL+ +AG E+ S G I++D + + P R + Sbjct: 23 LHDVCLDIRHGEFLTILGPSGCGKTTLLRLLAGFESPSSGEIILDGRSMRDVPPDGRRVN 82 Query: 81 MVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKLLQIEHLLSRKPGQLSGGQ 140 VFQSYAL+P MSV DN+AFGL++ +P EI E VA+ +++ + R+P LSGGQ Sbjct: 83 TVFQSYALFPHMSVFDNVAFGLRMSGIPKVEIGERVAKALRMVGLAGQAGRRPTSLSGGQ 142 Query: 141 QQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEAM 200 QQRVA+ RA+ RP + L DEPLS LD KLRV+MRTE+K + + + T ++VTHDQ EA Sbjct: 143 QQRVAIARAVVNRPLVLLLDEPLSALDYKLRVQMRTELKQLRREMGITFIFVTHDQEEAF 202 Query: 201 TLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPPMNFIPLRLQRKDGRLLALLD 260 ++ D+V VM +G + Q GTP ++Y P N+FVA F+G N + DG +L L Sbjct: 203 SMSDRVVVMNEGCVAQVGTPVEVYEQPVNMFVARFVGE--TNVFEGVAGQSDGGILQALV 260 Query: 261 SGQARCELP--LGMQDAGLEDREVILGIRPEQIILANGE 297 G+ CEL G Q DR +L +RPE +++ E Sbjct: 261 EGRT-CELSSHRGFQPG---DRIRVL-LRPEDLLVEREE 294 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 370 Length adjustment: 30 Effective length of query: 356 Effective length of database: 340 Effective search space: 121040 Effective search space used: 121040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory