Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_078716120.1 B5D49_RS02695 amino acid ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_900167125.1:WP_078716120.1 Length = 243 Score = 159 bits (401), Expect = 9e-44 Identities = 91/241 (37%), Positives = 141/241 (58%), Gaps = 6/241 (2%) Query: 20 LQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQID 79 ++++ + K+FG EVLKGIDL V GE V +GPSG GKST+LR I LE+ TSG+V +D Sbjct: 2 IKIQDLHKSFGDLEVLKGIDLTVNKGEVVCIIGPSGSGKSTVLRCINKLEEPTSGTVVVD 61 Query: 80 GVEV----GHVAPAKRGIAMVFQSYALYPHLTVKDNMGLG-LKQAGVPKAEIEEKVAKAA 134 G ++ ++ + MVFQ + L+PH+ V N+ LG +K G+ +AE ++ + Sbjct: 62 GHDIMAPKTNINYVRTEAGMVFQQFNLFPHMNVLANVTLGPIKVRGMRRAEADKLGLELL 121 Query: 135 GMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIAR 194 + L P +LSGGQ+QRVAI R++ +P++ LFDEP S LD L V LE+ + Sbjct: 122 EKVGLADKARNYPEQLSGGQKQRVAIARSLALQPRVMLFDEPTSALDPEL-VGEVLEVMK 180 Query: 195 LHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQ 254 TM+ VTH+ A +AD+++ ++ G I++ P + P N + F+G Q Sbjct: 181 QLAEEGMTMVVVTHEMHFAREVADRVIFIDQGVIQEENEPEAFFANPQNPRLRDFLGKVQ 240 Query: 255 M 255 + Sbjct: 241 L 241 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 243 Length adjustment: 26 Effective length of query: 326 Effective length of database: 217 Effective search space: 70742 Effective search space used: 70742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory