Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_078717009.1 B5D49_RS06865 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_900167125.1:WP_078717009.1 Length = 370 Score = 161 bits (408), Expect = 2e-44 Identities = 93/208 (44%), Positives = 125/208 (60%), Gaps = 4/208 (1%) Query: 7 QAVSRVFETAKG-QRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRV 65 Q+V R+ AK L V ++R +F+TILGPSGCGK+TLLR++AG + +SG + Sbjct: 5 QSVIRLEHVAKEFDGETVLHDVCLDIRHGEFLTILGPSGCGKTTLLRLLAGFESPSSGEI 64 Query: 66 LLDGAP---VEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAK 122 +LDG V G VFQSY LFP +++ N+ FGLR G+P+ + ER A + Sbjct: 65 ILDGRSMRDVPPDGRRVNTVFQSYALFPHMSVFDNVAFGLRMSGIPKVEIGERVAKALRM 124 Query: 123 VGLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIW 182 VGL G P LSGG QQR AIARA+ N P +LL+DEP ALD + RV M+ L + Sbjct: 125 VGLAGQAGRRPTSLSGGQQQRVAIARAVVNRPLVLLLDEPLSALDYKLRVQMRTELKQLR 184 Query: 183 EAERKTVLFVTHDIDEAIFMANRVAVFS 210 T +FVTHD +EA M++RV V + Sbjct: 185 REMGITFIFVTHDQEEAFSMSDRVVVMN 212 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 370 Length adjustment: 27 Effective length of query: 232 Effective length of database: 343 Effective search space: 79576 Effective search space used: 79576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory