Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_234990628.1 B5D49_RS05345 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_900167125.1:WP_234990628.1 Length = 256 Score = 166 bits (419), Expect = 6e-46 Identities = 87/193 (45%), Positives = 113/193 (58%) Query: 24 LQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAERGMVF 83 L VD + + ++GPSGCGKSTLL ++GL H G VLL G PV P E ++ Sbjct: 29 LADVDLALSSGRTLAVVGPSGCGKSTLLYALSGLLHPARGSVLLRGEPVVRPTQEISIIL 88 Query: 84 QSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGGMQQR 143 Q Y L PW T+ QN+ GL+ RG A + + A + +VG+ G + FP LSGG QQR Sbjct: 89 QDYGLLPWRTVLQNVTLGLKIRGTSRAVRCDMARAQLRQVGIVGRDNDFPGALSGGEQQR 148 Query: 144 TAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEAIFMA 203 AIARA + P +LLMDEPF +LD TR +Q LL W R L VTH ++EAIF+ Sbjct: 149 VAIARAFVSSPSVLLMDEPFSSLDALTRERLQATLLETWNRNRTPYLLVTHSLEEAIFLG 208 Query: 204 NRVAVFSARPGRI 216 R+ V + P RI Sbjct: 209 GRIVVLAGCPARI 221 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory