Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_078716395.1 B5D49_RS04225 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_900167125.1:WP_078716395.1 Length = 309 Score = 145 bits (367), Expect = 8e-40 Identities = 91/293 (31%), Positives = 167/293 (56%), Gaps = 17/293 (5%) Query: 4 SQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAY-----LTWWANTSGIN 58 +Q + NG+ +G + AL A+G T+ YGI++L NFAHG+F Y L++ A ++ Sbjct: 9 AQQMLNGLTLGGLYALIALGYTMVYGIIQLINFAHGEFFAAGGYMGVILLSYMAGAGYMD 68 Query: 59 L--WL----SMALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILL 112 WL S+ L V + E + +KP+R ++ ++++ ++G+++FL+N ++L Sbjct: 69 THPWLCIGFSLVLSMVYCAMLAMAVEKVAYKPLR--HSSRLSVLLSALGMSIFLQNALML 126 Query: 113 IWGGNNQNYRVPIVPAQ-DFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVA 171 G ++ Y I A + G+ Y ++L++A+ +V L+ ++ +T+VG+AMRA A Sbjct: 127 TQGVYDKAYPGGIFGAPFEVGGVIVNYMQILILALTAGLLVALNFLVFKTRVGRAMRATA 186 Query: 172 DNVDLAKVSGINVEWVVMWTWVMTAVLTALGGSMYGL-MTTLKPNMGWFLILPMFASVIL 230 + ++ + GIN V+ T+ + A L A G M G +++ MG+ + FA+ +L Sbjct: 187 QDKVMSALVGINSNRVISLTFAIGAGLAAAAGIMVGFYYGSVRFEMGFVPGIKAFAAAVL 246 Query: 231 GGIGNPYGAIAGGIIIGVAQEVSVPW--FGTSYKMGVALLLMIIILFIRPQGL 281 GGIGN GA+ GG IIG+ + ++ + +G YK A +++I +L+ RP G+ Sbjct: 247 GGIGNITGAMLGGFIIGMVEIMAAAYIPYGGEYKDVCAFIILIAVLYFRPTGI 299 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 309 Length adjustment: 26 Effective length of query: 260 Effective length of database: 283 Effective search space: 73580 Effective search space used: 73580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory