Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_078715760.1 B5D49_RS00865 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_900167125.1:WP_078715760.1 Length = 245 Score = 182 bits (462), Expect = 5e-51 Identities = 103/246 (41%), Positives = 155/246 (63%), Gaps = 11/246 (4%) Query: 1 MSDLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPS-- 58 M+ LL ++D+ Y ++ L G++F++ GE+VT+IG NGAGKST +I L P Sbjct: 1 MNPLLEIEDLRVRY-GNIEALHGVSFTVEEGEIVTLIGANGAGKSTTLMSIARLPPPEAP 59 Query: 59 ---QGEIIFKGENITGLGSDQIVRR-GMCYVPQVCNVFGSLTVAENLDMGAFLHQGPT-- 112 G+I KG ++ + D++V VP+ ++FG+L+V ENL + + +G + Sbjct: 60 KVISGDIRHKGVSLLNMPPDKVVSDLHTALVPEGRHIFGNLSVEENLKLATYARKGDSVP 119 Query: 113 --QTLKDRIYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPI 170 Q D++Y++FP+LA+RR Q++ +LSGGE+QMLA+GRALM +++LDEPS L+P Sbjct: 120 DIQRDYDQVYSLFPRLAERRKQQSESLSGGEQQMLAVGRALMSKCSIIMLDEPSMGLAPA 179 Query: 171 LVKDVFAQIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVG 230 L+ D+F +K +N G I+LVEQNA AL A RGYVL+ G +G+ LL DP V Sbjct: 180 LMYDMFRTLKQLNEEGMTILLVEQNANLALKFAHRGYVLDTGEIVAQGTSAELLEDPEVK 239 Query: 231 ELYLGA 236 + YLGA Sbjct: 240 KAYLGA 245 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 245 Length adjustment: 23 Effective length of query: 217 Effective length of database: 222 Effective search space: 48174 Effective search space used: 48174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory