Align Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized)
to candidate WP_200806748.1 B5D49_RS00095 branched-chain amino acid ABC transporter substrate-binding protein
Query= SwissProt::P21175 (373 letters) >NCBI__GCF_900167125.1:WP_200806748.1 Length = 395 Score = 230 bits (587), Expect = 4e-65 Identities = 127/338 (37%), Positives = 191/338 (56%), Gaps = 3/338 (0%) Query: 27 ADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQAV 86 A I + + G +G +A YG A + E+IN GGV G ++ V DD C P++A Sbjct: 49 AGEIVLGVPGAHSGDLASYGLPTVNAAELVAEKINAEGGVLGRMVKVVAQDDECKPEKAT 108 Query: 87 AVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRG-YKLIFRTI 145 A K++++GV V+GH+CS +T+ A IY + ++ ++PSAT P +T G Y FRTI Sbjct: 109 NAATKLLSEGVHVVLGHICSGATKAALPIYTETRIVCMSPSATNPPLTQSGDYPNFFRTI 168 Query: 146 GLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVE-DAGIKVAVFEGLNA 204 D+ Q + F A++ TIAV+HDK YG+G A+ + VE D + V +FEG+ Sbjct: 169 ASDDAQAQLGVDF-AKKIGLTTIAVIHDKGDYGKGFASFARDFVEADPDMNVVLFEGVTP 227 Query: 205 GDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIA 264 G D++A++ K+K +G V FGGYHPE ++ Q ++ LD F+ +GV + +A Sbjct: 228 GAVDYSAVVQKIKNSGADGVIFGGYHPEASKIVSQMRKKDLDLPFISDDGVKDDTFIKVA 287 Query: 265 GDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEA 324 G+ +EG+ A+ PR +P + +DA KAK G F AYSA + IEKAG Sbjct: 288 GEYAEGVYASGPRDISGNPLYQVALDAHKAKYGTEPGAFFYEAYSAALALLNAIEKAGST 347 Query: 325 DPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYE 362 D + V ALR +TP G + FD KGD + F++Y+ Sbjct: 348 DYDAVVNALRTEYVDTPVGKIKFDAKGDAEGVGFSMYQ 385 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 395 Length adjustment: 30 Effective length of query: 343 Effective length of database: 365 Effective search space: 125195 Effective search space used: 125195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory