Align Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA carboxylase biotin-containing subunit; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 (characterized)
to candidate WP_268802025.1 B5D49_RS04650 biotin carboxylase N-terminal domain-containing protein
Query= SwissProt::Q96RQ3 (725 letters) >NCBI__GCF_900167125.1:WP_268802025.1 Length = 470 Score = 213 bits (543), Expect = 1e-59 Identities = 165/471 (35%), Positives = 240/471 (50%), Gaps = 41/471 (8%) Query: 48 NITKVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSY 107 N KVLIANRGEIA R+M LG VAVY+ D+ S HV+ A A SY Sbjct: 2 NKHKVLIANRGEIAVRIMEACHDLGHDFVAVYTAEDQASGHVETARTLGGEHCAYRISSY 61 Query: 108 LSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAE--LCKQEGIIFIGPPPSAIRDMGIKST 165 +I VA + A AIHPG GF SEN FA + +Q +IFIGP IRD+G K Sbjct: 62 NDAGEIFSVADAAQATAIHPGYGFFSENYRFARRVVQRQRPMIFIGPSWWVIRDLGDKIN 121 Query: 166 SKSIMAAAGVPVVEG----YHGEDQSDQCLK-----EHARRIGYP-VMIKAVRGGGGKGM 215 +K + + VP V G + E ++++ + + A+ I P V++KA GGGG G+ Sbjct: 122 TKRLARSLNVPTVPGSDRAIYDELEAEEIAENLFDFQEAQGISCPVVLVKASAGGGGMGI 181 Query: 216 RIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLF-ER 274 V F++ R + + FND+ +LIE+ V H+EVQ+ + G F R Sbjct: 182 DEVPDMDRFRQIYRRIRNYSMRQFNDEGVLIEQRVFDFNHLEVQIVSERSGQRHVTFGTR 241 Query: 275 DCSVQR-RHQKIIEEAPA---PGI-----KSEVRKKLGEAAVRAAKAVNYVGAGTVEFIM 325 +CSVQ QK IE AP GI +V + + ++R A+A+ Y GT E+I+ Sbjct: 242 NCSVQSPGRQKRIETAPGFYPDGITYSFDAQKVLDDITDYSLRMAEAIKYDSVGTWEWIV 301 Query: 326 DSKHNFCFMEMNTRLQVEHPVTEMIT------GTDLVEWQLRIAAGEKIPLSQEEITLQG 379 K + +E+NTR+QVE+ V+ I G +L+ Q+R+A G+ + SQ++IT +G Sbjct: 302 TPKGDPFLLEVNTRIQVENGVSAAIARIHGKDGVNLLREQIRLALGDPMGYSQKDITFEG 361 Query: 380 HAFEARIYAEDPSNNFMPVAGPLVHL---STPRADPSTRIETGVRQGDEVSVHYDPMIAK 436 + E RI AED +N F P G + S P T + T + ++ YDP +A Sbjct: 362 VSIEYRIIAEDTTNRFQPWVGQIDTFQWKSAPWLTMHTHVPTD--RAYQIPTEYDPNLAL 419 Query: 437 LVVWAADRQAALTKLRYSLRQYNIVG-------LHTNIDFL-LNLSGHPEF 479 +VW AD + A + +L ++ G L +N+DFL N G EF Sbjct: 420 AIVWGADLEEAKARGMVALDGVDLQGNDTAGLELKSNLDFLRTNNKGLLEF 470 Lambda K H 0.317 0.131 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 706 Number of extensions: 38 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 725 Length of database: 470 Length adjustment: 36 Effective length of query: 689 Effective length of database: 434 Effective search space: 299026 Effective search space used: 299026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory