Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_200806763.1 B5D49_RS03200 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_900167125.1:WP_200806763.1 Length = 406 Score = 221 bits (562), Expect = 4e-62 Identities = 127/341 (37%), Positives = 207/341 (60%), Gaps = 23/341 (6%) Query: 4 LKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLY 63 ++L + KR+ K +V+ +L I E + +GPSGCGK+T LRMIAGLE T+G++Y Sbjct: 45 VRLQGLMKRF--GKTVAVQETDLTIETGELVTLLGPSGCGKTTILRMIAGLETPTKGDIY 102 Query: 64 IDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEIL 123 I + +ND R++ M+FQNYAL+PH +++EN+AFGLK R ++++ ++V +A E++ Sbjct: 103 IKGRRINDTPIHKRNLGMIFQNYALFPHKTIFENVAFGLKYRNVSREEMREKVAQALEMV 162 Query: 124 GLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHR 183 L +R + LSGGQ+QR+A+ RAIV + V LMDEPLS LD KLR MR EI I + Sbjct: 163 RLPGVEKRYASQLSGGQQQRIALARAIVIEPDVLLMDEPLSALDEKLREEMRMEIDNIQQ 222 Query: 184 RIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVA 243 ++ TT++VTHDQ EA++++++IV+M GR +Q GTP+++Y+ P N FVA Sbjct: 223 QLNLTTLFVTHDQREALSMSNKIVVMKD----------GRKQQEGTPEDVYDYPDNYFVA 272 Query: 244 GFIGSPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKG--YLGKKVTLGIRPE--D 299 F+G NFF+ V + +++ D + + + +G E + G G+ V L +R + + Sbjct: 273 DFLGH--ANFFDARVLE--VLDNDQVRVRIAEGLEFTADHVGRWRQGQDVHLVMRAQKIN 328 Query: 300 ISSDQIVHETFPNASVT---ADILVSELLGSESMLYVKFGS 337 ++S + E + + I +G E+ +V+ + Sbjct: 329 VTSPDLADEELESTDLNYYPGKIYDRSYMGGETSYFVELAN 369 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 406 Length adjustment: 31 Effective length of query: 346 Effective length of database: 375 Effective search space: 129750 Effective search space used: 129750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory