Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_200806763.1 B5D49_RS03200 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_900167125.1:WP_200806763.1 Length = 406 Score = 211 bits (538), Expect = 2e-59 Identities = 107/221 (48%), Positives = 149/221 (67%) Query: 17 KEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRD 76 K V++ +L I GE + L+GPSGCGK+T LRM+AGLE T G I+I + + Sbjct: 56 KTVAVQETDLTIETGELVTLLGPSGCGKTTILRMIAGLETPTKGDIYIKGRRINDTPIHK 115 Query: 77 RDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKAL 136 R++ M+FQNYAL+PH T+ EN+ F LK S++E+ ++V +A + L +R L Sbjct: 116 RNLGMIFQNYALFPHKTIFENVAFGLKYRNVSREEMREKVAQALEMVRLPGVEKRYASQL 175 Query: 137 SGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQ 196 SGGQ+QR+A+ RAIV P V LMDEPLS LD KLR + R +I +Q++L +TT++VTHDQ Sbjct: 176 SGGQQQRIALARAIVIEPDVLLMDEPLSALDEKLREEMRMEIDNIQQQLNLTTLFVTHDQ 235 Query: 197 TEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIG 237 EAL+M ++I V+KDG QQ G P ++YD P N FVA F+G Sbjct: 236 REALSMSNKIVVMKDGRKQQEGTPEDVYDYPDNYFVADFLG 276 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 406 Length adjustment: 31 Effective length of query: 345 Effective length of database: 375 Effective search space: 129375 Effective search space used: 129375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory