Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate WP_078716120.1 B5D49_RS02695 amino acid ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >NCBI__GCF_900167125.1:WP_078716120.1 Length = 243 Score = 163 bits (412), Expect = 5e-45 Identities = 92/242 (38%), Positives = 142/242 (58%), Gaps = 6/242 (2%) Query: 17 LVQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIML 76 ++++ + K F EV+ +DLT+N GE + ++GPSG GK+TVLR I LE SG +++ Sbjct: 1 MIKIQDLHKSFGDLEVLKGIDLTVNKGEVVCIIGPSGSGKSTVLRCINKLEEPTSGTVVV 60 Query: 77 DNEDITHVPAENRYVNT----VFQSYALFPHMTVFENVAFG-LRMQKTPAAEITPRVMEA 131 D DI YV T VFQ + LFPHM V NV G ++++ AE +E Sbjct: 61 DGHDIMAPKTNINYVRTEAGMVFQQFNLFPHMNVLANVTLGPIKVRGMRRAEADKLGLEL 120 Query: 132 LRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELK 191 L V L A+ P QLSGGQ+QRVAIAR++ +PR++L DE SALD +L ++ +K Sbjct: 121 LEKVGLADKARNYPEQLSGGQKQRVAIARSLALQPRVMLFDEPTSALDPELVGEVLEVMK 180 Query: 192 ALQRKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEI 251 L + G+T V VTH+ A ++DR++ + G I+++ P + P+N + F+G++ Sbjct: 181 QLAEE-GMTMVVVTHEMHFAREVADRVIFIDQGVIQEENEPEAFFANPQNPRLRDFLGKV 239 Query: 252 NM 253 + Sbjct: 240 QL 241 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 243 Length adjustment: 27 Effective length of query: 351 Effective length of database: 216 Effective search space: 75816 Effective search space used: 75816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory