Align ABC transporter related; Flags: Precursor (characterized, see rationale)
to candidate WP_078716498.1 B5D49_RS04560 ABC transporter ATP-binding protein
Query= uniprot:B2T9V9 (510 letters) >NCBI__GCF_900167125.1:WP_078716498.1 Length = 514 Score = 214 bits (546), Expect = 5e-60 Identities = 149/475 (31%), Positives = 242/475 (50%), Gaps = 10/475 (2%) Query: 12 VPVVEALEVTKRFGSTAALNDVSIRVMPGESHALVGRNGAGKSTLVSILTGLRKPDTGEV 71 +P+V +TKRFG A +D+S+ + PG AL+G NGAGKSTL+S+L G +PD G + Sbjct: 22 IPLVSIKGLTKRFGKVVANDDISLNIYPGRVKALLGENGAGKSTLMSMLAGRYQPDAGTI 81 Query: 72 RFSGAAAPSIADRDAWRERVACVYQHSTIIRDLSVAENLFINRQPLRGGVIDWQAMRRDA 131 G + RDA + VYQH ++ ++VAEN+ + ++ ++ + MR Sbjct: 82 ALDGKPVRFSSARDAIEAGIGMVYQHFMLVESMTVAENVLLGQE--GSFFLNPKEMRNRV 139 Query: 132 RALLDHWKIDVREDARAGDLSVEARQLVEIARALSYGARFIILDEPTAQLDGDEIKRLFR 191 + L + +D+ AR DLS+ +Q VEI + L +R +I DEPTA L E LF Sbjct: 140 QELSVRYGLDIDPAARVSDLSMGEKQRVEILKLLYRDSRVLIFDEPTAVLTPRETFHLFE 199 Query: 192 RISELQREGVTFLFISHHLQEVYEICQAVTVLRDARHIVSAPVSAL-PREQLIEAMTGER 250 + ++ +G + +FISH L+EV + + +LR R S + + L M G+ Sbjct: 200 ALWKIAEQGKSIVFISHKLEEVLAVADEIAILRQGRIEGEFSESEVTSKADLACRMVGKE 259 Query: 251 GGLAVADAAARGALPADTAVALELKELTGADYEGVSFTVKRGEVVGLTGATSSGRTSVAE 310 L V R A+P AV L+++ LTG E ++F + +GEVV + G +G+ ++ E Sbjct: 260 VLLEV----DREAMPHGDAV-LQVRNLTGIGLEDITFDLHQGEVVAVVGVAGNGQKALVE 314 Query: 311 AIAGLRAAKRGTISVDGAILPPGDVPASLAHGIGCVPKDRHHEGLVLTQSVAENASMTIA 370 AI GLR T+ + G S + + +P+DR ++ +N +T Sbjct: 315 AICGLRKPPVDTMFIMGKRWRDFYAKPSWKNSLAYIPEDRLGLATCRNLNLVDNLLLTTR 374 Query: 371 RVLGKFGIAAPAKKNAFGQKMIDALGIVAQGPEHVVSGLSGGNQQKVVMARALATNPNVL 430 + + K ++I I + LSGGN QK V+AR L P ++ Sbjct: 375 QGFARGPWLDKKKAARDTTELIKKFDIRPGRIAALAWQLSGGNLQKSVLARELYRCPRLI 434 Query: 431 VLIDPTAGVDVKSKEALLSVVDRVREEGKAVLVVSGELDD-LRTCDRVLVMFRGR 484 V PT G+D+ + E + + + RE +L+V+G+L++ L+ DRV V++RGR Sbjct: 435 VAEQPTQGLDIAATEQVWNHLLAAREMA-GILLVTGDLNEALQLADRVAVIYRGR 488 Lambda K H 0.318 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 32 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 514 Length adjustment: 35 Effective length of query: 475 Effective length of database: 479 Effective search space: 227525 Effective search space used: 227525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory