Align TreV, component of Trehalose porter (characterized)
to candidate WP_078718206.1 B5D49_RS13305 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_900167125.1:WP_078718206.1 Length = 341 Score = 177 bits (448), Expect = 4e-49 Identities = 94/206 (45%), Positives = 136/206 (66%), Gaps = 3/206 (1%) Query: 29 EFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPEKRNVAMVFQNYALYPN 88 EFF +LGP+G GKS LL+ +AG+ G++ G DIT PPE+RN+ MV+Q++AL+P+ Sbjct: 27 EFFALLGPTGSGKSVLLESVAGLLPGRSGRVFLKGQDITKLPPEQRNLGMVYQDHALFPH 86 Query: 89 MSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGISEILDKKVTQISGGQQQRVALARAIV 148 ++VR NIAF + G + RV++ A+LLGI+ +LD+ + +SGG++QRVALARA+V Sbjct: 87 LNVRRNIAFGQRYHG---DADAGRVQELAELLGIAHLLDRSLHGLSGGERQRVALARALV 143 Query: 149 RNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTFIYVTHDQKEALSLADRIAILHK 208 P LLDEPLS LD R + LK + +E+ TF+ VTHD EAL LADR A++ Sbjct: 144 VRPQVLLLDEPLSALDPNSRRGVKQMLKDLHREMGITFLMVTHDFDEALFLADRAAVIRD 203 Query: 209 GKFEQVSDPKTLYEYPKTKWVAQFVG 234 G+ Q ++ P ++VA+FVG Sbjct: 204 GRVVQQGAVADIFHRPADRFVAEFVG 229 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 341 Length adjustment: 28 Effective length of query: 296 Effective length of database: 313 Effective search space: 92648 Effective search space used: 92648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory