Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_078716944.1 B5D49_RS06875 spermidine/putrescine ABC transporter permease PotC
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_900167125.1:WP_078716944.1 Length = 255 Score = 81.3 bits (199), Expect = 2e-20 Identities = 54/164 (32%), Positives = 86/164 (52%), Gaps = 4/164 (2%) Query: 69 INSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLW-FWFITNRMISP-IVLALPFFLI 126 +NSL +A+ + A +LGV A+ AL R+ FRGK+ + FI M+SP IV+ + ++ Sbjct: 60 LNSLTVAVLSATAATMLGVLASVALYRYRFRGKQIMQSVLFIL--MVSPDIVMGVALLVL 117 Query: 127 ARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICL 186 +GL +TL+L + TF LP V V+ + G L EAA+ GA +F R + L Sbjct: 118 FMFIGLKPGFLTLLLAHTTFCLPFVTVTVSSRLAGFDGHLIEAAQDLGAGEFQAFRHVLL 177 Query: 187 PLAMPGVAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFM 230 P+ +P V + SF S ++++ +T E P S + Sbjct: 178 PMLLPAVVAGWLLSFTLSMDDVIISFFVTGPEFDILPLRVYSMV 221 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 255 Length adjustment: 25 Effective length of query: 247 Effective length of database: 230 Effective search space: 56810 Effective search space used: 56810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory