Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate WP_078716695.1 B5D49_RS05670 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P39359 (301 letters) >NCBI__GCF_900167125.1:WP_078716695.1 Length = 294 Score = 150 bits (379), Expect = 3e-41 Identities = 94/296 (31%), Positives = 158/296 (53%), Gaps = 5/296 (1%) Query: 4 FSGIIPPVSSTFHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAE 63 F+G + + F RDG +D+ A R + ++ I +G+DG+ GT GE + M ++ + Sbjct: 3 FNGAFTALVTPF-RDGAIDEDAYRNLIEWQIEQGIDGVVPCGTTGEAATMTHEEQGRVIR 61 Query: 64 EAVTIVDGRVPVLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQ 123 V V GR+PV+ G GS +T EA++L Q A+ GAD + I PYY K P + +++ Sbjct: 62 ICVEQVKGRIPVIAGAGSNNTKEAIQLTQLAKDAGADATLQITPYYNKPTPGGIVAHFKA 121 Query: 124 IARSVTLPVILYNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSV 183 IA ++P++LYN P TG + P TV +A + + +K ++ G+LR + Sbjct: 122 IAAECSIPMVLYNVPGRTGLNCLPATVAAVAKEVPEVKAVK---EATGNLRQGAEVRELC 178 Query: 184 RPSFSVFCGYDDHLLNTMLLGGDGAITASANFAPELSVGIYRAWREGDLATAATLNKKLL 243 P F++ G D +L + +GG+G I+ +N AP+L + RA+RE D A A L+ KL Sbjct: 179 GPDFALLSGDDFTVLPLLSVGGNGVISVVSNIAPKLMSDMCRAYREQDTAKALELSLKLA 238 Query: 244 QLPAIYALETPFVSLIKYSMQCVGLPVETYCLPPILEASEEAKDKVHVLLTAQGIL 299 L LET + +K S+ +G+ T P++ E ++ + +L G++ Sbjct: 239 PLNRAMFLETNPIP-VKTSLTYMGVTERTEFRLPLVPLLAENREPLQRVLKDAGLM 293 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 294 Length adjustment: 26 Effective length of query: 275 Effective length of database: 268 Effective search space: 73700 Effective search space used: 73700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory