Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_084058302.1 B9A12_RS12460 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900176285.1:WP_084058302.1 Length = 361 Score = 162 bits (410), Expect = 1e-44 Identities = 91/247 (36%), Positives = 144/247 (58%), Gaps = 10/247 (4%) Query: 1 MVRIIVKNVSKVF----KKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDV 56 M RI ++ V+ + K AL N++ E+G + +LGPSG GKTT + II+GL Sbjct: 1 MARITLQQVAHSYQRHPKDPSDYALKNIDTVWEDGGAYALLGPSGCGKTTMLNIISGLLT 60 Query: 57 PSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEE 116 P+ G + +DDR V +PPE R I VFQ LY ++ F+N+AFPL N + + Sbjct: 61 PTRGRVLYDDRDVTE-----LPPEQRNIAQVFQFPVLYDTMSVFDNLAFPLRNRGLDPQT 115 Query: 117 IRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVK-DPSLLLLDEPFSNLDARM 175 I +RV+EVA++LD+ L LS +Q+++L R LV+ D + +L DEP + +D + Sbjct: 116 IHRRVQEVAEVLDLTADLKKKAAGLSADAKQKISLGRGLVREDVAAILFDEPLTVIDPHL 175 Query: 176 RDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSI 235 + R +KE+ +L +TL+ V+HD + AD+V V+ +G++VQ+G P +L++ P Sbjct: 176 KWHLRRKLKEIHEKLQLTLIYVTHDQVEALTFADKVLVMYEGEMVQMGTPAELFEEPRHK 235 Query: 236 QVASLIG 242 V IG Sbjct: 236 FVGYFIG 242 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 361 Length adjustment: 29 Effective length of query: 324 Effective length of database: 332 Effective search space: 107568 Effective search space used: 107568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory