Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_084058309.1 B9A12_RS12470 carbohydrate ABC transporter permease
Query= TCDB::O30493 (276 letters) >NCBI__GCF_900176285.1:WP_084058309.1 Length = 267 Score = 145 bits (365), Expect = 1e-39 Identities = 76/252 (30%), Positives = 128/252 (50%) Query: 24 LIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHINERSNYFSYAWNSVLISFSAT 83 L+ PI+WM+ S + D A+ F TL NY+ I S+++S NS++ T Sbjct: 16 LLILPIYWMLNMSLRANADILASFALFPRNATLANYMKIFTDSSWYSGYINSMIYVSLNT 75 Query: 84 ALCLLISVPAAYSMAFYETKRTKSTLLWMLSTKMLPPVGVLMPIYLLAKSFGLLDTRIAL 143 + L ++PAAY+ + + K W+L+ +M PP L+P + L +F L+DT IA+ Sbjct: 76 IISLTTALPAAYAFSRFRFIGDKHVFFWLLTNRMAPPAVFLLPFFQLYSTFHLIDTHIAV 135 Query: 144 IIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQEMVRVLLPIAKGGLASTVLL 203 + + L N+P+ VW++ + IP++I E A +DG + + + V +P+ + G+ T Sbjct: 136 ALAHCLFNVPLAVWILEGFMSGIPREIDETAFIDGYSFPRFFLTVFVPLIRAGIGVTAFF 195 Query: 204 SLILCWNEAFWSLNLTSSNAAPLTALIASYSSPEGLFWAKLSAVSTLACAPILIFGWISQ 263 + W E + LT +NA P+ A + S GL W L+A L P + W + Sbjct: 196 CFMFSWVELLLARTLTITNAKPIVATMTRTVSASGLDWGLLAAAGVLTIVPGALVIWFVR 255 Query: 264 KQLVRGLSFGAV 275 L +G + G V Sbjct: 256 NHLAKGFALGRV 267 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 267 Length adjustment: 25 Effective length of query: 251 Effective length of database: 242 Effective search space: 60742 Effective search space used: 60742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory