Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate WP_084055726.1 B9A12_RS01255 ABC transporter ATP-binding protein
Query= uniprot:P70970 (276 letters) >NCBI__GCF_900176285.1:WP_084055726.1 Length = 248 Score = 143 bits (361), Expect = 3e-39 Identities = 83/215 (38%), Positives = 125/215 (58%), Gaps = 7/215 (3%) Query: 9 ALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLK 68 AL + I ++V V G G GK+TLL L GL +P G + L + AG D + Sbjct: 17 ALRGVTFRIATPAFVVVCGANGQGKTTLLHLLAGLFRPDAGSLRLLG-LDPAG----DAQ 71 Query: 69 KLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVGLSEELLDR 128 +R +VG+VFQ P+ Q+ ETV +D++FGP N G+ K + Q+ + L GL E L D+ Sbjct: 72 AVRARVGLVFQDPDSQILGETVGEDVAFGPENLGLSKAEVRQRVQAALARFGL-ESLRDK 130 Query: 129 SPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTTIL 188 + LSGG+ RRVA+AGVLA DP V++ DEP LD G + ++D+ L + G T ++ Sbjct: 131 PCYALSGGEKRRVALAGVLAADPSVILFDEPFTHLDWPGSRALLDLLLNLRREGR-TVVV 189 Query: 189 VTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLK 223 TH +E A+AD ++V+ G + G P ++ L+ Sbjct: 190 STHDVEKVLAHADRVMVLQGGRLADEGPPSEVALR 224 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 248 Length adjustment: 25 Effective length of query: 251 Effective length of database: 223 Effective search space: 55973 Effective search space used: 55973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory