GapMind for catabolism of small carbon sources

 

Protein WP_085125301.1 in Tistlia consotensis USBA 355

Annotation: NCBI__GCF_900177295.1:WP_085125301.1

Length: 337 amino acids

Source: GCF_900177295.1 in NCBI

Candidate for 25 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK hi SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 76% 100% 502.3 ABC transporter for D-Sorbitol, ATPase component 73% 478.0
D-sorbitol (glucitol) catabolism mtlK hi ABC transporter for D-Sorbitol, ATPase component (characterized) 73% 100% 478 N-Acetyl-D-glucosamine ABC transport system, ATPase component 63% 413.3
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 63% 95% 413.3 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 63% 95% 413.3 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 61% 97% 391.7 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 61% 97% 391.7 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 61% 97% 391.7 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 57% 100% 365.2 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 52% 100% 338.2 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 52% 100% 328.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 52% 100% 328.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 52% 100% 328.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 48% 98% 318.2 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 61% 70% 313.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 49% 99% 309.3 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 51% 88% 295.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
trehalose catabolism malK med MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 53% 76% 288.1 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 48% 87% 255 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 62% 66% 293.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 36% 99% 208.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 76% 502.3

Sequence Analysis Tools

View WP_085125301.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MGAITLDKVTKAFGTMAVIPGVDLEIADGEFVVFVGPSGCGKSTLLRLIAGLEDVTSGAI
RIDGSDATRVAPARRRLAMVFQSYALYPHMSVYNNIAFPLKMAGQDKATIRRKVEGAARI
LNLTDYLERRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEISELH
QSLKTTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLELYNRPANVFVAGFIGSPKMN
LLEGAAAERHGAATIGIRPEHLEVSTGAGGEWSGVVGVVEHLGSDTFLHVQVEGLGPVTA
RVGGELDIRHGSRVWLTPPPERLHRFGADGQAIRQAA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory