Align BadK (characterized)
to candidate WP_085123321.1 B9O00_RS14075 enoyl-CoA hydratase-related protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_900177295.1:WP_085123321.1 Length = 260 Score = 200 bits (508), Expect = 3e-56 Identities = 110/256 (42%), Positives = 156/256 (60%), Gaps = 2/256 (0%) Query: 2 SSNPILTET-QGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA 60 +S P+L+E V ++ +NR +V NALN A AL A A D+ + AIV+ GN A Sbjct: 4 ASQPVLSERIDEAVVLVRINRGEVRNALNTATRKALAEAFAACHDDESVRAIVLTGNEEA 63 Query: 61 FAAGADIASMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIV 120 FAAGAD+ A D+ + W+TI +P++AAV G A GGG ELA+ DI+ Sbjct: 64 FAAGADLKEFMAAGAVDIARGRS-EKYWKTIMATPQPIIAAVNGFALGGGMELAMMADII 122 Query: 121 IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV 180 +AG A F PE+++G++PGAGGTQRL RA+GK AM +CL+ +P++A EA R GLVS++ Sbjct: 123 VAGEGATFGQPEVRVGIMPGAGGTQRLTRAVGKYNAMRLCLTGKPIDAAEAYRIGLVSQL 182 Query: 181 VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADA 240 V D + + +A ++A AL A KE++ + ++L G+ ERR L FAS D Sbjct: 183 VPDAEVLATALDMARSLARLPPLALQATKEAILHSENTSLEAGLAMERRALQVLFASRDK 242 Query: 241 REGIQAFLEKRAPCFS 256 EG+ AF EKR P F+ Sbjct: 243 NEGMTAFFEKRRPSFT 258 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory