Align Purine/cytidine ABC transporter permease protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate WP_085124809.1 B9O00_RS21595 ABC transporter permease
Query= TCDB::A2RKA5 (317 letters) >NCBI__GCF_900177295.1:WP_085124809.1 Length = 311 Score = 149 bits (375), Expect = 1e-40 Identities = 97/294 (32%), Positives = 150/294 (51%), Gaps = 10/294 (3%) Query: 20 PLIFTSIGGVFSERGGIVNVGLEGIMTIGAFSSVVFNLTTAGMFGSMTPWLSILFGALIG 79 PL+ +G SE+ G++N+GLEG+M GA+ F A GS L L G G Sbjct: 23 PLLLAGLGEQISEKAGVLNIGLEGMMLFGAY----FGFAVAYQSGSFA--LGFLAGGAAG 76 Query: 80 ALFSSLHAVATVNLRADHIVSGTVLNLMAPALGVFLLQVFYQQGQININEQIGYWNVPLL 139 A+ + + + V L + IV G + L L L + + + ++IG VP L Sbjct: 77 AVAALVMVLLCVRLGMNQIVVGIAITLAGEGLTALLHYFTFARSYPRL-DKIGTLAVPGL 135 Query: 140 SNIPVIGKIFFTQTSLPGFLAIVVAILAWYVLFKTRFGLRLRSVGENPQAADTLGINVYA 199 S +PV+G F + SL +LA+++ +V +T+FGL L++ G+ P A D G++V Sbjct: 136 SGLPVVGDALFNR-SLLVYLAVLLPFALIWVFRRTQFGLNLQAAGDKPAALDAAGVSVMG 194 Query: 200 YRWAGVLLSGVLGGVGGAIYAQAISGNFSVSTIAGQGFISLAAMIFGKWNPIGAMLSSLL 259 R A VLL+G LGG+GGA + G F G GFIS+ + + P+ + + L Sbjct: 195 TRAAAVLLTGFLGGLGGAYLSTVGGGLFLPFMTGGAGFISIVLAMLARGKPLWVLFGAFL 254 Query: 260 FGLFTSLAVVGGQIPGIKEIPSSFLQMAPYVFTIIVLALFLGKAIAPKADGVNY 313 FG SL Q+ GI ++P+ +QM P+ I+VL +F + P A G+ Y Sbjct: 255 FGASLSL-TTAMQVAGI-DVPTDVIQMLPFAMVILVLVVFGRHSYLPPALGLPY 306 Lambda K H 0.326 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 311 Length adjustment: 27 Effective length of query: 290 Effective length of database: 284 Effective search space: 82360 Effective search space used: 82360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory