Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate WP_085124648.1 B9O00_RS20760 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >NCBI__GCF_900177295.1:WP_085124648.1 Length = 317 Score = 165 bits (418), Expect = 1e-45 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 4/246 (1%) Query: 42 RPTVEIMAKPPVWIPETLSLDAYRAMFSGAGQGGVPVWDYFRNSLIVSVTSTVIALAIGL 101 R T E +AK P + R M VP F NSLI+ STV A+A+G Sbjct: 75 RQTPEFIAKLPPATSTCEVISRSRNMVIAGPSNYVP---RFVNSLIIGFGSTVFAVALGT 131 Query: 102 SGGYAFARYRFKAKSAIFLGFMLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALN 161 Y F+R++ + + TR +P IA+++P++++Y G+ DT ++L Y A+N Sbjct: 132 FAAYGFSRFKVPLADDLLFFILSTRMMPPIAVAIPIYLMYRELGLSDTRLGMVLLYTAVN 191 Query: 162 VPFTIWLIDGFFRQVPKDLAEAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNE 221 V +WL+ GF ++P++ EAA IDG + +AFW+V P A GIA+ IF + +WNE Sbjct: 192 VSLAVWLLKGFIDEIPREYEEAAMIDGYSRLRAFWKVVLPQATTGIAATAIFCLIFAWNE 251 Query: 222 YALASQITRSVNSKTLPVGLLDYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGL 281 YA A +T S N++T P + E DW + A + +VP L T +++KHL+ G+ Sbjct: 252 YAFAVLLT-SGNAQTEPPFIPIIIGEGGQDWPAVAAGTTIFLVPILVFTILLRKHLLRGI 310 Query: 282 TFGAVK 287 TFGAV+ Sbjct: 311 TFGAVR 316 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 288 Length of database: 317 Length adjustment: 27 Effective length of query: 261 Effective length of database: 290 Effective search space: 75690 Effective search space used: 75690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory