Align L-fuconate dehydratase; FucD; EC 4.2.1.68 (characterized)
to candidate WP_085121732.1 B9O00_RS06885 mandelate racemase/muconate lactonizing enzyme family protein
Query= SwissProt::Q8P3K2 (441 letters) >NCBI__GCF_900177295.1:WP_085121732.1 Length = 383 Score = 112 bits (281), Expect = 2e-29 Identities = 94/339 (27%), Positives = 143/339 (42%), Gaps = 61/339 (17%) Query: 98 QLRWLGP----EKGVMHMAIGAVINAAWDLAARAANKPLWRFIAELTPEQLVDTIDFRYL 153 Q R + P +G HMAI A+ A WD R A +P+ + Sbjct: 84 QARMVAPLAIDRRGQCHMAISALDIALWDAWGRIAGQPIHALLG---------------- 127 Query: 154 SDALTRDEALAILRDAQPQRAARTATLIEQGYPAYTTSPGWLGYSDEKLVRLAKEA---V 210 LRD PAY + P +L + ++ LA E Sbjct: 128 ----------GALRDR---------------VPAYASGP-FLEAAPDRYGALAGEVERYA 161 Query: 211 ADGFRTIKLKVGANVQDDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDI 270 A GFR IKL+VG ++ D R AR+ +G + + D N+ V A+ +A+ + Sbjct: 162 AAGFRAIKLRVGTDLATDASAIRQARSILGAEALLMADLNEGSTVRDAVALTEAVADARL 221 Query: 271 AWIEEPTSPDDVLGHAAIRQGITPVPVSTGEHTQNRVVFKQLLQAGAVDLIQIDAARVGG 330 +WIEEP DD+ G+ + Q + +P++ GE F+ L AGA+D++Q D A GG Sbjct: 222 SWIEEPIPHDDLPGYRRLAQ-LLSLPLAGGESFSGTQAFRDFLAAGALDIVQPDLAICGG 280 Query: 331 VNENLAILLLAAKFGVRVFPHAGGVGLCELVQHLAMADFVAI----TGKMEDRAIEF--- 383 + E L + LA F V PH G G + LA F A+ G + E+ Sbjct: 281 LTEGLRVAALADAFETAVAPHVWGTG----INFLASLQFAAVLTPRRGPVPFPLFEYDMG 336 Query: 384 VDHLHQHFLDPVRIQHGRYLAPEVPGFSAEMHPASIAEF 422 ++ L DP + GR P+ PG E+ +A++ Sbjct: 337 INPLRSALYDPQPDRDGRLAVPDGPGLGIEISIDRLADY 375 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 383 Length adjustment: 31 Effective length of query: 410 Effective length of database: 352 Effective search space: 144320 Effective search space used: 144320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory