Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate WP_085124748.1 B9O00_RS21260 galactofuranose ABC transporter, permease protein YjfF
Query= SwissProt::P37772 (331 letters) >NCBI__GCF_900177295.1:WP_085124748.1 Length = 320 Score = 289 bits (739), Expect = 7e-83 Identities = 151/306 (49%), Positives = 206/306 (67%), Gaps = 1/306 (0%) Query: 4 RNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDL 63 R LPL+ T+ VF ++ + F +T V+ +IL DNAF+ I A+G TFVILSGGIDL Sbjct: 4 RYLPLLATMTVFAALFVTGGVFYKHFFTTLVLGHILADNAFIIIAAIGTTFVILSGGIDL 63 Query: 64 SVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAG 123 S+GS+I F GV +A + G PL + L+L G A+GAF G +ID K+ FIITLAG Sbjct: 64 SIGSMIGFVGVVMAN-LDAAGWHPLASAALMLAFGLAYGAFQGFVIDFCKVQPFIITLAG 122 Query: 124 MFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLLMLAVVVIGIFLAHRT 183 +F LRG ++V+ +S+P+ HP D + L P GG L++ ++MLA + + +AH T Sbjct: 123 LFLLRGACFMVNIDSVPLRHPFVDAFADLYIPFPTGGFLTSSAMVMLAALAAAVVIAHFT 182 Query: 184 RFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGV 243 RFG +VYAIGG+ SA LMG+ R T + +Y L + L G+++++YT +GY LAG G Sbjct: 183 RFGAKVYAIGGDPASAELMGVPARRTIVSVYALGGFYSALGGVIYALYTSSGYPLAGTGN 242 Query: 244 ELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGILLFI 303 EL AIA+VV+GGTLLSGGVG V GTLFG I GLI T INF+G+L+S W I+ G LLF+ Sbjct: 243 ELSAIAAVVLGGTLLSGGVGLVAGTLFGGMILGLISTLINFNGSLNSAWIMISGGALLFV 302 Query: 304 FIALQR 309 FI +Q+ Sbjct: 303 FIVIQK 308 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 320 Length adjustment: 28 Effective length of query: 303 Effective length of database: 292 Effective search space: 88476 Effective search space used: 88476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory