Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate WP_085123269.1 B9O00_RS13785 carbohydrate kinase
Query= SwissProt::Q53W83 (309 letters) >NCBI__GCF_900177295.1:WP_085123269.1 Length = 314 Score = 85.1 bits (209), Expect = 2e-21 Identities = 89/263 (33%), Positives = 118/263 (44%), Gaps = 14/263 (5%) Query: 5 VTAGEPLVALVPQEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAM 64 + GE L L E H + +GG+ NVAV LARLG + D LG Sbjct: 3 LVCGEALWDLFAVEAEH---SLRFDARIGGSPFNVAVGLARLGQPAALFTGISTDRLGTR 59 Query: 65 VEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLE 124 + E L EGV R+ + L L + G +Y +G+A ++ P P Sbjct: 60 LVEALDREGVATDLLVRSARPSTLSLVDLGADGVPVYAFYGEGAADRSVRPDQL-PALGP 118 Query: 125 GVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEA--RGFLER 182 V LH + A+ P + EA RR VSLD N R T+ P+ R ++R Sbjct: 119 EVWGLHAGSYSLAVEPVGSSLLALIEREAGRR--LVSLDPNVRLTV-EPDTGLWRDRVDR 175 Query: 183 ALPGVDLLFLSEEEAELLF---GRVEEALRALSAPE--VVLKRGAKGAWAFVDGRRVEGS 237 L DL+ +S+E+ LL+ G E A LSA VV+ RGA+GA AF RV Sbjct: 176 FLRLSDLVKVSDEDLALLYPGTGAAEIAGHWLSAGAGLVVVTRGAEGAEAFSAAGRVAMP 235 Query: 238 AFAVEAVDPVGAGDAFAAGYLAG 260 V VD VGAGD F A +AG Sbjct: 236 GRPVAVVDTVGAGDTFQAALIAG 258 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 314 Length adjustment: 27 Effective length of query: 282 Effective length of database: 287 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory