Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate WP_085123761.1 B9O00_RS16330 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >NCBI__GCF_900177295.1:WP_085123761.1 Length = 361 Score = 202 bits (513), Expect = 1e-56 Identities = 123/335 (36%), Positives = 187/335 (55%), Gaps = 16/335 (4%) Query: 19 DSDYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQ 78 D AL +E DG LGPSGCGKTT L + +GL P+ G++ F R V P Sbjct: 15 DGSVALQDFSLEVADGEFLTFLGPSGCGKTTTLRMTAGLETPTSGEIFFGERPVVDLPPG 74 Query: 79 ERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAG 138 RNIA VFQ +Y MTV +NL +PLR + V + +R +A L++ L++R Sbjct: 75 RRNIAMVFQSYALYPHMTVQQNLEYPLRKQGVARDERARRATALAATLQLDALLHRRPKH 134 Query: 139 LAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTH 198 L+ +Q+++LGR L+R + L DEPL+ +D L+ Q+R +L Q+H + T+IYVTH Sbjct: 135 LSGGQQQRVALGRALIR-EPEVFLLDEPLSNLDAELRTQMRAELIQLHRRIGRTMIYVTH 193 Query: 199 DQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAH---RDGE 255 DQVEA+T + ++ VM++G+ QVG+ ++ P + FV F+GSP MNF+ RDG Sbjct: 194 DQVEAMTMSTRIAVMSKGELQQVGTPLEIYREPRNRFVAAFVGSPAMNFVEGGIELRDGR 253 Query: 256 NL-SVAGHRLASPVGRA------LPAGALQVGIRPEYLALAQPQQAGALPGTVVQVQDIG 308 + AG +A P R+ A + GIRPE+L+L + G+ G V+ V+ +G Sbjct: 254 AVFRAAGLEVALPDARSARLAGLARASGVLAGIRPEHLSL----EPGSGEGRVLVVEAMG 309 Query: 309 TYQMLTAKVGEHTVKARFTPETRLPSSGDTAWLQV 343 ++TA+ + R + T ++GD L+V Sbjct: 310 HEDIVTAETPAGRIVVR-SAGTATAAAGDLVPLRV 343 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 361 Length adjustment: 29 Effective length of query: 329 Effective length of database: 332 Effective search space: 109228 Effective search space used: 109228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory