Align Putative aldehyde dehydrogenase transmembrane protein; EC 1.2.1.3 (characterized, see rationale)
to candidate WP_179243903.1 B9O00_RS00790 aldehyde dehydrogenase family protein
Query= uniprot:Q92L07 (510 letters) >NCBI__GCF_900177295.1:WP_179243903.1 Length = 480 Score = 231 bits (590), Expect = 3e-65 Identities = 160/455 (35%), Positives = 235/455 (51%), Gaps = 19/455 (4%) Query: 52 AAEAAGKIEKADEAFRAWRLVPAPKRGELVRLLGEELRAFKADLGRLVSIEAGKIPSEGL 111 AA+A I+ A AF AW +R +++ G E+ A K +LGRL+S E GK EG+ Sbjct: 39 AAQAGQAIDAAAAAFPAWSRSTPQQRFDILDAAGTEILARKEELGRLLSREEGKTLPEGI 98 Query: 112 GEVQEMIDICDFAVGLSRQLYGLTIATERPGHRMMETWHPLGVVGIISAFNFPVAVWSWN 171 GE I F G + ++ G I + RPG T PLGVVG+I+ +NFP+A+ +W Sbjct: 99 GETVRAGQIFKFFAGEALRIAGDRIDSTRPGVIAEATREPLGVVGLITPWNFPIAIPAWK 158 Query: 172 AALALVCGDAVVWKPSEKTPLTALACQAILERAIARFGDAPEGLSQVLIG-DRAIGEVLV 230 A AL G+ VV KP++ P A A IL+RA P+G+ +++G +GE ++ Sbjct: 159 LAPALAFGNCVVMKPADLVPGCAWALADILQRA-----GLPKGVFNLVMGRGSVVGEAIL 213 Query: 231 DHPKVPLVSATGSTRMGREVGPRL--AKRFARAILELGGNNAGIVCPSADLDMALRAIAF 288 PKV +S TGS GR V R + + LE+GG N +V ADL++A + Sbjct: 214 ASPKVAAISFTGSVATGRHVARRCIEGEAMKKFQLEMGGKNPFVVLDDADLEVAANSALN 273 Query: 289 GAMGTAGQRCTTLRRLFVHESVYDQLVPRLKKAYQSVSVGNPLESAALVGPLVDKAAFDG 348 GA + GQRCT RL V E ++D+ V L +++ V N L+ +GP+VD+ D Sbjct: 274 GAFFSTGQRCTASSRLIVTEGIHDRFVEALTSKLKALKVDNALKEGTQIGPVVDQRQLDQ 333 Query: 349 MQKAIAEAKNHGGAVT-GGERVELGHENGYYVKPAL-VEMPKQEGPVLEETFAPILYVMK 406 I ++ G + GGER+ E G+Y++PAL E EE F P+ V++ Sbjct: 334 DLDYIKVGQDEGAKLAWGGERLNRETE-GFYLQPALFTETDNAMRINREEIFGPVASVIR 392 Query: 407 YSDFDAVLAEHNAVAAGLSSSIFTRDMQESERFLAADGSDCGIANVNIGTSGAEIGGAFG 466 D+D+ LA N GLS+ I T ++ +E F S G+ VN+ T+G + FG Sbjct: 393 VKDYDSALAVANDTQFGLSAGIATSSLKHAEHF--KRNSQAGMVMVNLPTAGVDYHVPFG 450 Query: 467 GEKETG-GGRESGSDAWKAYMRRATNTVNYSKALP 500 G K + G RE G A + Y TV + A+P Sbjct: 451 GRKNSSYGAREQGRYAVEFY-----TTVKTAYAMP 480 Lambda K H 0.317 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 480 Length adjustment: 34 Effective length of query: 476 Effective length of database: 446 Effective search space: 212296 Effective search space used: 212296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory