Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_085123761.1 B9O00_RS16330 ABC transporter ATP-binding protein
Query= TCDB::O30494 (367 letters) >NCBI__GCF_900177295.1:WP_085123761.1 Length = 361 Score = 291 bits (746), Expect = 1e-83 Identities = 160/358 (44%), Positives = 228/358 (63%), Gaps = 11/358 (3%) Query: 1 MANLKIKNLQKGF-EGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGT 59 M +++ ++L K F +G ++ LEV D EF+ F+GPSGCGK+T LR+ AGLE + G Sbjct: 1 MVSVRYQHLHKAFGDGSVALQDFSLEVADGEFLTFLGPSGCGKTTTLRMTAGLETPTSGE 60 Query: 60 IELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAAR 119 I R + ++ P +R++AMVFQ+YALYPHM+V++N+ + L GV + + A Sbjct: 61 IFFGERPVVDLPPGRRNIAMVFQSYALYPHMTVQQNLEYPLRKQGVARDERARRATALAA 120 Query: 120 ILELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARL 179 L+L LL R+PK LSGGQ+QRVA+GRA++R P++FL DEPLSNLDA LR QMR EL +L Sbjct: 121 TLQLDALLHRRPKHLSGGQQQRVALGRALIREPEVFLLDEPLSNLDAELRTQMRAELIQL 180 Query: 180 HKELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKM 239 H+ + TMIYVTHDQVEAMT++ ++ V++ G ++QVG+PLE+Y +P N FVA F+G+P M Sbjct: 181 HRRIGRTMIYVTHDQVEAMTMSTRIAVMSKGELQQVGTPLEIYREPRNRFVAAFVGSPAM 240 Query: 240 GFLKGKVTRVDGQGCEVQLDAGTLISLPLSG----ASLSVGSAVTLGIRPEHLEIASPGQ 295 F++G + DG+ V AG ++LP + A L+ S V GIRPEHL + PG Sbjct: 241 NFVEGGIELRDGRA--VFRAAGLEVALPDARSARLAGLARASGVLAGIRPEHLSL-EPGS 297 Query: 296 TTLTVTADVGERLGSDTFCHVITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFD 353 V V E +G + T G + +R G + G+ + L +DP HLFD Sbjct: 298 GEGRVL--VVEAMGHEDIVTAETPAGR-IVVRSAGTATAAAGDLVPLRVDPEKLHLFD 352 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 361 Length adjustment: 29 Effective length of query: 338 Effective length of database: 332 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory