Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_085123269.1 B9O00_RS13785 carbohydrate kinase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3036 (314 letters) >NCBI__GCF_900177295.1:WP_085123269.1 Length = 314 Score = 313 bits (803), Expect = 3e-90 Identities = 169/311 (54%), Positives = 209/311 (67%), Gaps = 5/311 (1%) Query: 1 MYLVCGEALFDFFSENDASGLASKVNFKAIAGGSPFNVAVGLRRLGVDAALLAGLSTDYL 60 M+LVCGEAL+D F+ L F A GGSPFNVAVGL RLG AAL G+STD L Sbjct: 1 MFLVCGEALWDLFAVEAEHSL----RFDARIGGSPFNVAVGLARLGQPAALFTGISTDRL 56 Query: 61 GRRLLQVLQDEGVCLDYLLEFAAPTTLAMVAVGANGSPQYSFRGEGCADRQLQAEHLPTL 120 G RL++ L EGV D L+ A P+TL++V +GA+G P Y+F GEG ADR ++ + LP L Sbjct: 57 GTRLVEALDREGVATDLLVRSARPSTLSLVDLGADGVPVYAFYGEGAADRSVRPDQLPAL 116 Query: 121 GPEVRGLHIGSFSLVVQPIADTLLALVRRESGKRLISLDPNVRLNPEPDIDLWRKRVATL 180 GPEV GLH GS+SL V+P+ +LLAL+ RE+G+RL+SLDPNVRL EPD LWR RV Sbjct: 117 GPEVWGLHAGSYSLAVEPVGSSLLALIEREAGRRLVSLDPNVRLTVEPDTGLWRDRVDRF 176 Query: 181 VELADLIKVSDEDLHLLYPDQDPAQVIEGWLQHRCQLVFLTRGGEGATVFSRAHGSWSAP 240 + L+DL+KVSDEDL LLYP A++ WL LV +TRG EGA FS A G + P Sbjct: 177 LRLSDLVKVSDEDLALLYPGTGAAEIAGHWLSAGAGLVVVTRGAEGAEAFSAA-GRVAMP 235 Query: 241 ACSVKIADTVGAGDTFQAALITWLTEQQLDSVEGVKQLGREQIDRMLKFAVRAAALTCSK 300 V + DTVGAGDTFQAALI L E + + L REQ+ R+L FAV AAA+TC++ Sbjct: 236 GRPVAVVDTVGAGDTFQAALIAGLAEAGVRRRAALDALDREQVGRLLDFAVGAAAITCTR 295 Query: 301 TGPDLPYRKQL 311 G DLP R +L Sbjct: 296 RGADLPRRAEL 306 Lambda K H 0.321 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 314 Length adjustment: 27 Effective length of query: 287 Effective length of database: 287 Effective search space: 82369 Effective search space used: 82369 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory