Align ABC-type sugar transport system, periplasmic component protein (characterized, see rationale)
to candidate WP_085123266.1 B9O00_RS13770 sugar ABC transporter substrate-binding protein
Query= uniprot:D8IZC6 (316 letters) >NCBI__GCF_900177295.1:WP_085123266.1 Length = 340 Score = 99.8 bits (247), Expect = 8e-26 Identities = 88/302 (29%), Positives = 141/302 (46%), Gaps = 25/302 (8%) Query: 6 IAIACSTLLLAA-AAQPAMAADKPLKSVGVTVGDLANPFFVAIAKGAESGAHKINPDAKV 64 + + ST+L A AA PA AAD VG+ NPFFV + +GAE+ A ++ + + Sbjct: 5 LRLMASTVLAACLAAGPAAAADT---IVGLVTKTNTNPFFVKMREGAEAKAKELGVELRS 61 Query: 65 TVVSSKYDLNTQVGQIENFIANKVDLIVLNAADSKGVGPAVKKAQKAGIVVVAVDV---A 121 D+ +QV IE+ IA I++ +DS V PA+ +A+KAG++V+A+D Sbjct: 62 YAGKYDGDVESQVEAIESLIAAGAKGILITPSDSAAVVPALARARKAGLLVIALDTPLDP 121 Query: 122 AAGADVTVMSDNTMAGAESCKFLAEKLQGKGN-----VVIVNGPPVSAVMDRVTGCKAEF 176 A+ AD T +DN AG ++ +L K ++ +N +S + R G F Sbjct: 122 ASAADATFATDNFKAGQLIGEWAKARLGDKAEDAKIAMLDLNANQISVDVARDQGFLEGF 181 Query: 177 KKSPG-IKILSDNQN--------AGGSRDGGMTTMSNLLAAQPKIDAVFAINDPTAIGAE 227 G K + D ++ G+ +GG M NL+ P ++ V+ IN+P A GA Sbjct: 182 GIDIGNPKQIGDEKDGRIVGHDITQGAEEGGRRAMENLMQRNPSLNLVYTINEPAAAGAY 241 Query: 228 LAIRQAKRSDIKWISGVDGAPDAERALKDSKSLFAASPAQDPYGMAAESV--AIGYAVMN 285 A+R I +DG + +K + A+ Q P MA+ + + YA Sbjct: 242 EALRSFGLDSQATIVSIDGGCPGVKNVK--AGVIGATSMQFPLRMASLGIEAVVDYARTG 299 Query: 286 GR 287 R Sbjct: 300 AR 301 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 340 Length adjustment: 28 Effective length of query: 288 Effective length of database: 312 Effective search space: 89856 Effective search space used: 89856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory