Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_085123267.1 B9O00_RS13775 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_900177295.1:WP_085123267.1 Length = 354 Score = 190 bits (482), Expect = 5e-53 Identities = 122/322 (37%), Positives = 180/322 (55%), Gaps = 11/322 (3%) Query: 26 QWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTF 85 Q L H L + P V + +L L++ + G NF +A N I++QV I VL T Sbjct: 32 QQLHHFLHVNPTAVPIVVL--ALSVAVFGTVAGNFFTAFNMTLIIQQVTIIGVLGVAQTL 89 Query: 86 VILTAGIDLSVGSVLAVSAVL--GMQVSLGAAPGWAIPMFIFSGLVMGMVNGAMVALLNI 143 +ILTAGIDLSV +++ +S+V+ + V+LG AIP+ + G++ G NG +V L + Sbjct: 90 IILTAGIDLSVAAIMVLSSVVMGSLAVNLGVPTLVAIPVGLLIGVLCGAFNGVLVTLFRL 149 Query: 144 NAFVVTLGTMTAFRGAAYLLADGTTVLNNDI----PSFEWIGNGDFLHVPWLIWVAVAVV 199 F+VTLG F L+ G ++ + DI P ++ G+ L A+ ++ Sbjct: 150 PPFIVTLGAWKIFFALNLWLSGGESIRSQDIDAAAPLLKFWGDRFALGGAQFTGGAILML 209 Query: 200 LLS---WVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSAS 256 LL W +L KT G H+YAIG + AA L+GI G VL+ VY ++G L ++ Sbjct: 210 LLFGLFWFLLNKTAWGRHVYAIGDDRDAATLSGIPTGRVLISVYVVAGFLCALGAWVAIG 269 Query: 257 RLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSF 316 R+ + LDAI AVV+GG SL GG GSI GT+VGALI+GV +GL + G+ Sbjct: 270 RVGSVSPQSFYEGNLDAITAVVIGGCSLFGGRGSILGTLVGALIVGVFRSGLNLSGVDVL 329 Query: 317 WQYVAKGAVIVLAVILDKWRQK 338 WQ A GA+I++AV +D+W +K Sbjct: 330 WQQFAVGALIIVAVAIDQWLRK 351 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 354 Length adjustment: 29 Effective length of query: 315 Effective length of database: 325 Effective search space: 102375 Effective search space used: 102375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory