Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_200808618.1 B9O00_RS21325 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_900177295.1:WP_200808618.1 Length = 341 Score = 186 bits (473), Expect = 6e-52 Identities = 114/332 (34%), Positives = 185/332 (55%), Gaps = 18/332 (5%) Query: 15 PGARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVA 74 PGA + S + L RLG+LP L+++ ++ + L + NF + N N+ RQ Sbjct: 9 PGAA-APSLWLKRLFVRLGVLPFLLIVAVIVFTLM-------SDNFLTGRNLANVARQSV 60 Query: 75 INLVLAAGMTFVILTAGIDLSVGSVLAVSAVLG---MQVSLGA---APGWAIPMF----I 124 +++ G F +LT G DLSVG++LA+++V+G M + GA APG AI + I Sbjct: 61 YLTIVSLGQMFALLTGGFDLSVGTILALTSVVGALAMAAAFGAMPDAPGLAIAIGCLAGI 120 Query: 125 FSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGD 184 +G +G+ NG VA+ N++ F++TLG + G A L G V + G G Sbjct: 121 LAGTAIGLFNGVGVAIFNVSPFIMTLGMASIGFGIALFLTGGVPVYGMPQEFGDVFGFGA 180 Query: 185 FLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISG 244 + + ++VA ++++ ++++ T LG + YA+GGN++AARL+GI VL Y I Sbjct: 181 WFGIDVPVYVAALLIVVVYLLVNWTPLGRYFYAVGGNIKAARLSGIGTRTVLFATYVICA 240 Query: 245 LFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVM 304 L + L G + +RL N G+ L++IAA V+ G SL GGVG + V+GAL I ++ Sbjct: 241 LLTALGGMLLTARLDTGEANIGASMPLESIAACVIAGVSLRGGVGRVENVVLGALFINLV 300 Query: 305 NNGLTILGLSSFWQYVAKGAVIVLAVILDKWR 336 NG+ + + S+ Q V G +++LAV+ D+ R Sbjct: 301 QNGMNLARIESYLQTVVLGVLLILAVVADQLR 332 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 341 Length adjustment: 29 Effective length of query: 315 Effective length of database: 312 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory