Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_085122755.1 B9O00_RS11180 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_900177295.1:WP_085122755.1 Length = 302 Score = 318 bits (815), Expect = 1e-91 Identities = 161/302 (53%), Positives = 200/302 (66%), Gaps = 8/302 (2%) Query: 1 MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTV 60 MR+GIDLGGTK +AL G L R R TPR DY T+E IA +V E TG+RG+V Sbjct: 1 MRLGIDLGGTKISGLALDQQGRTLARCRSATPRGDYAATLEAIAAIVARLEAETGRRGSV 60 Query: 61 GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA 120 G+ IPG++S TG+VKNANSTWL G+P D+DL+ RL R VR+ NDANC A+SEA DGA A Sbjct: 61 GVAIPGTVSSLTGLVKNANSTWLIGEPLDRDLAERLDRPVRVENDANCFALSEATDGAGA 120 Query: 121 GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGK 180 GA TVF VI+GTG G G+ GR G +G AGEWGHNPLPW +DE R PCYCG+ Sbjct: 121 GAPTVFGVILGTGVGGGLVVEGRPLPGRDGIAGEWGHNPLPWPQDDE---RPGPPCYCGR 177 Query: 181 QGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVV 240 +GC+ETF+SG A + SG A + E +P A+ AL RY RL + LAHV+ Sbjct: 178 RGCVETFLSGPALAREAGAGSGEA-----AVLAAEAGEPRAQAALARYVERLGRGLAHVI 232 Query: 241 NILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLWP 300 NI DP V+VLGGG+S + LY+ V + +VF +TP+R + G SGVRGAAWLW Sbjct: 233 NIFDPHVVVLGGGLSELPLLYREVPPRLAGWVFSDRPDTPIRAPRFGADSGVRGAAWLWR 292 Query: 301 QE 302 +E Sbjct: 293 EE 294 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 302 Length adjustment: 27 Effective length of query: 275 Effective length of database: 275 Effective search space: 75625 Effective search space used: 75625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory