Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_085126658.1 B9O00_RS29715 ATP-binding cassette domain-containing protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_900177295.1:WP_085126658.1 Length = 260 Score = 177 bits (449), Expect = 2e-49 Identities = 95/243 (39%), Positives = 147/243 (60%), Gaps = 3/243 (1%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 PL+ M+GIE FG V A+ GVS+D++ GE LLG NGAGKST IK +SG G+IL Sbjct: 7 PLVEMRGIEVAFGGVKAVDGVSLDLYAGEVVGLLGHNGAGKSTLIKVLSGAVPARAGEIL 66 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYAN 125 +G + A P+DA I T++Q LA+ ++ + N F+G E G L D + Sbjct: 67 IDGAAVRIASPQDARRHRIETIYQTLALADNLNAAANLFLGRELTTPTG---LLDEERME 123 Query: 126 RITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTA 185 T + ++ N V +LSGG+RQ++AIARAVHF A++LI+DEPT+ALGV++TA Sbjct: 124 AETRRILARLNRNFDRFSTPVRSLSGGQRQSIAIARAVHFDARILIMDEPTAALGVQETA 183 Query: 186 NVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMA 245 V + +++ +G+ + I+H++ + DR TVL G+ +GT + + + +E+ M+ Sbjct: 184 MVAELVRQLKAEGIGIFLISHDIHDVFDLSDRVTVLKNGRLVGTRRVAETTQDEVLAMII 243 Query: 246 GGQ 248 G+ Sbjct: 244 QGE 246 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 260 Length adjustment: 25 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory