Align Nucleoside permease; Flags: Precursor (characterized, see rationale)
to candidate WP_235017227.1 B9O00_RS29460 nucleoside transporter C-terminal domain-containing protein
Query= uniprot:A0KU05 (419 letters) >NCBI__GCF_900177295.1:WP_235017227.1 Length = 408 Score = 249 bits (636), Expect = 1e-70 Identities = 145/425 (34%), Positives = 251/425 (59%), Gaps = 35/425 (8%) Query: 7 LVGVVVLLAIGFLLSNNKKAINLRTVGGALAIQAAFGGFVLYVPVGKDILKSVSDAVSSV 66 ++G+ ++AI + +S N+K + R V LA+Q +L +P +D+ +++ V ++ Sbjct: 1 MLGIAAIVAIAWAVSENRKVFDWRGVVAGLALQFGLAFLLLRLPGARDVFLALNGLVLAL 60 Query: 67 IGYAQNGIGFLFGDL----ANFKL-----GFIFAVNVLPVIVFFSSLIAVLYYLGIMQWI 117 + G F+FG L A F+ F+ A+ LP+I+ S+L A+L++ I+ + Sbjct: 61 QDATRQGTAFVFGYLGGGPAPFEATQPGNSFVLALQALPLILVISALSALLWHWRILPVV 120 Query: 118 IRIIGGGLQKALGTSRTESMSATANIFVGQTEAPLVVRPFIPTMTQSELFAIMVGGLASI 177 ++ + L++ +SA ANIFVG EAPL+VRP+ +T++E+F +M G+A++ Sbjct: 121 VKAVSAVLERIFAIGGAVGVSAAANIFVGMVEAPLLVRPYFARLTRAEIFMVMTCGMATV 180 Query: 178 AGSVLAGYA---QMGVP--IEYLVAASFMAAPGGLLMAKLMHPETEVAKND--MDELPED 230 AG+V+ YA +P + +++ AS ++ P L++A+LM P E ++D + EL D Sbjct: 181 AGTVMVLYASFLSQVIPGALGHILTASIISVPAALMVARLMVPGVEKTESDGSIPELEYD 240 Query: 231 PDKPANVLDAAAAGASSGMHLALNVGAMLLAFVGLIAMINGIIGGVGGWFGVEGLTLELI 290 + +DA G G+ L +NV AML+ + L+A++N ++G + FG E L+L+ + Sbjct: 241 -----SSMDAITRGTEQGVQLLINVTAMLIVLIALVALVNALLGLLPPVFGAE-LSLQRV 294 Query: 291 LGYIFMPLAFLIGVPWNEALVAGSFIGQKIVVNEFVAYLNFAPYLKDIADGGMIVADTGL 350 G+IF P A+LIG+P +EA AG +G K V+NEF+AYL A + ADT Sbjct: 295 FGWIFAPYAWLIGIPAHEAATAGELLGLKTVLNEFIAYLQLA----------KLPADT-- 342 Query: 351 AMTDRTKAIISFALCGFANLSSIAILLGGLGAMAPNRRHDLAKLGIRAVIAGSLANLMSA 410 + +R++ I+ +ALCGFAN S+ I++GGL AMAP RR +L +L ++V++G+LA ++ Sbjct: 343 -LDERSRLILVYALCGFANPGSLGIMIGGLVAMAPQRRGELVQLAGKSVLSGTLATGLTG 401 Query: 411 TIAGL 415 + G+ Sbjct: 402 AVVGI 406 Lambda K H 0.325 0.142 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 408 Length adjustment: 31 Effective length of query: 388 Effective length of database: 377 Effective search space: 146276 Effective search space used: 146276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory