Align Anthranilate 1,2-dioxygenase ferredoxin subunit (characterized)
to candidate WP_085120423.1 B9O00_RS00245 non-heme iron oxygenase ferredoxin subunit
Query= SwissProt::Q84BZ1 (108 letters) >NCBI__GCF_900177295.1:WP_085120423.1 Length = 101 Score = 85.1 bits (209), Expect = 2e-22 Identities = 36/99 (36%), Positives = 57/99 (57%) Query: 9 WHPLGAIDEFTEDEPAARVAGQKPIAVFRIGDELFAMHDLCSHGHARLSEGYVEDGCVEC 68 WH + + E G + +A++R+ ELFA ++C+H A L EGY+E +EC Sbjct: 3 WHRVANAGDVAEGAVIEVEVGNQQVALYRVAGELFATDNICTHAFACLHEGYLEGHTIEC 62 Query: 69 PLHQGLIDIRTGAPKCAPITEPVRVYPIRIVDGQVEVNV 107 PLHQG+ DIR+G P P+ EP+R +P++ V + + Sbjct: 63 PLHQGIFDIRSGEPLEGPVDEPLRTFPVKTEGDDVLIEI 101 Lambda K H 0.321 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 61 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 108 Length of database: 101 Length adjustment: 11 Effective length of query: 97 Effective length of database: 90 Effective search space: 8730 Effective search space used: 8730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory