GapMind for catabolism of small carbon sources

 

Alignments for a candidate for andAb in Tistlia consotensis USBA 355

Align Anthranilate 1,2-dioxygenase ferredoxin subunit (characterized)
to candidate WP_085124340.1 B9O00_RS19310 FAD-dependent oxidoreductase

Query= SwissProt::Q84BZ1
         (108 letters)



>NCBI__GCF_900177295.1:WP_085124340.1
          Length = 974

 Score = 82.4 bits (202), Expect = 1e-20
 Identities = 39/98 (39%), Positives = 55/98 (56%)

Query: 8   EWHPLGAIDEFTEDEPAARVAGQKPIAVFRIGDELFAMHDLCSHGHARLSEGYVEDGCVE 67
           EW  + A D   +          +P+A+ R G  + A+HD+CSH  A LS+G VEDGC+E
Sbjct: 2   EWIDVAAFDTLPDGGVRGFEVAGRPVALVRQGAVVHALHDICSHQFAFLSDGVVEDGCLE 61

Query: 68  CPLHQGLIDIRTGAPKCAPITEPVRVYPIRIVDGQVEV 105
           CPLHQG   ++TG     P+  PV  Y  ++  G+V V
Sbjct: 62  CPLHQGRFCLKTGKAMGGPVDAPVATYAAKVEGGRVLV 99


Lambda     K      H
   0.321    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 285
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 108
Length of database: 974
Length adjustment: 27
Effective length of query: 81
Effective length of database: 947
Effective search space:    76707
Effective search space used:    76707
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory