Align Anthranilate 1,2-dioxygenase ferredoxin subunit (characterized)
to candidate WP_085124340.1 B9O00_RS19310 FAD-dependent oxidoreductase
Query= SwissProt::Q84BZ1 (108 letters) >NCBI__GCF_900177295.1:WP_085124340.1 Length = 974 Score = 82.4 bits (202), Expect = 1e-20 Identities = 39/98 (39%), Positives = 55/98 (56%) Query: 8 EWHPLGAIDEFTEDEPAARVAGQKPIAVFRIGDELFAMHDLCSHGHARLSEGYVEDGCVE 67 EW + A D + +P+A+ R G + A+HD+CSH A LS+G VEDGC+E Sbjct: 2 EWIDVAAFDTLPDGGVRGFEVAGRPVALVRQGAVVHALHDICSHQFAFLSDGVVEDGCLE 61 Query: 68 CPLHQGLIDIRTGAPKCAPITEPVRVYPIRIVDGQVEV 105 CPLHQG ++TG P+ PV Y ++ G+V V Sbjct: 62 CPLHQGRFCLKTGKAMGGPVDAPVATYAAKVEGGRVLV 99 Lambda K H 0.321 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 108 Length of database: 974 Length adjustment: 27 Effective length of query: 81 Effective length of database: 947 Effective search space: 76707 Effective search space used: 76707 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory