Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_085123238.1 B9O00_RS13620 ATP-binding cassette domain-containing protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_900177295.1:WP_085123238.1 Length = 284 Score = 159 bits (403), Expect = 5e-44 Identities = 90/239 (37%), Positives = 146/239 (61%), Gaps = 4/239 (1%) Query: 23 RALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGI--QLTEESVWE 80 RALDGV L V GE LAI+G NG+GKSTL LNG + P +G++ + G + ++ + Sbjct: 16 RALDGVDLAVRPGEKLAILGANGAGKSTLLLLLNGSLRPAAGEVRLHGAPARYDRAALAD 75 Query: 81 VRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEP 140 R+ +G+V Q+PD+Q TV +DV+FG N G+ E+ ER+ A++ + + + D+ Sbjct: 76 WRRAVGLVLQDPDDQLFAATVFEDVSFGPLNQGLGEAEVRERITEALETLRIAELADRPT 135 Query: 141 HHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISIT 200 H LS GQ++RVA+AG++A RP++++LDE + LDP+G ++ + L +G T++ T Sbjct: 136 HMLSFGQRKRVALAGIVAMRPEVLLLDEPGAGLDPLGVAHLMAALDRLSGRG-TTIVLTT 194 Query: 201 HDLNEA-AKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGL 258 HD++ A ADRI + G+ A G + +F+ L R+ L P +++ +LL GL Sbjct: 195 HDMDLAYGWADRIAIFGEGRVAAAGSADAVFEDADLLKRLHLRRPLVWEVGRLLGSRGL 253 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 284 Length adjustment: 26 Effective length of query: 255 Effective length of database: 258 Effective search space: 65790 Effective search space used: 65790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory